Target General Infomation
Target ID
T40474
Former ID
TTDC00110
Target Name
Hepatocyte growth factor receptor
Gene Name
MET
Synonyms
C-Met receptor tyrosine kinase; C-met; HGF receptor; HGF-SF receptor; Met proto-oncogene tyrosine kinase; MET
Target Type
Successful
Disease Advanced cancers [ICD9: 140-229; ICD10: C00-C96]
ALK-positive advanced or metastatic NSCLC [ICD9: 162; ICD10: C33, C34]
Alzheimer disease [ICD9: 331; ICD10: G30]
Advanced solid tumor [ICD9: 140-199; ICD10: C00-C75, C7A, C7B]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Chemotherapy-induced mucositis [ICD9: 528; ICD10: K12.3]
Fibrosis [ICD9: 709.2; ICD10: L90.5]
Gastric cancer; Renal cell carcinoma; Squamous cell cancer of head and neck [ICD9: 140-229, 151, 189; ICD10: C16, C64]
Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33]
Hepatocellular carcinoma [ICD9: 155; ICD10: C22.0]
Heart disease [ICD9: 390-429; ICD10: I00-I52]
Liver disease [ICD9: 570-574; ICD10: K70-K77]
Medullary thyroid cancer [ICD9: 193; ICD10: C73]
Metastatic castration-resistant prostate cancer; Ovarian cancer [ICD9: 140-229, 183, 185; ICD10: C56, C61]
Metastatic HER2-negative gastric cancer; Non-small cell lung cancer [ICD9:140-229, 151; ICD10: C16, C33-C34]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Thyroid cancer; Renal cell carcinoma [ICD9: 140-229, 189, 193; ICD10: C64, C73]
Function
Acts as a receptor for Listeria internalin inlB, mediating entry of the pathogen into cells.
BioChemical Class
Kinase
Target Validation
T40474
UniProt ID
EC Number
EC 2.7.10.1
Sequence
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS
Structure
1FYR; 1R0P; 1R1W; 1SHY; 1SSL; 1UX3; 2G15; 2RFN; 2RFS; 2UZX; 2UZY; 2WD1; 2WGJ; 2WKM; 3A4P; 3BUX; 3C1X; 3CCN; 3CD8; 3CE3; 3CTH; 3CTJ; 3DKC; 3DKF; 3DKG; 3EFJ; 3EFK; 3F66; 3F82; 3I5N; 3L8V; 3LQ8; 3Q6U; 3Q6W; 3QTI; 3R7O; 3RHK; 3U6H; 3U6I; 3VW8; 3ZBX; 3ZC5; 3ZCL; 3ZXZ; 3ZZE; 4AOI; 4AP7; 4DEG; 4DEH; 4DEI; 4EEV; 4GG5; 4GG7; 4IWD; 4K3J; 4KNB; 4MXC; 4O3T; 4O3U
Drugs and Mode of Action
Drug(s) Cabozantinib Drug Info Approved Medullary thyroid cancer [541185], [550636]
Crizotinib Drug Info Approved ALK-positive advanced or metastatic NSCLC [468091], [531783]
Beperminogene perplasmid Drug Info Phase 3 Heart disease [524769]
RG3638 Drug Info Phase 3 Metastatic HER2-negative gastric cancer; Non-small cell lung cancer [525252]
Tivantinib Drug Info Phase 3 Solid tumours [532586], [542863]
AMG 208 Drug Info Phase 2 Solid tumours [525156]
AMG 337 Drug Info Phase 2 Cancer [524576]
Cabozantinib Drug Info Phase 2 Metastatic castration-resistant prostate cancer; Ovarian cancer [541185], [550636]
HM-5016504 Drug Info Phase 2 Cancer [524739]
INCB28060 Drug Info Phase 2 Hepatocellular carcinoma [549049]
LY-2875358 Drug Info Phase 2 Cancer [524369]
LY2801653 Drug Info Phase 2 Cancer [523337]
SAR-125844 Drug Info Phase 2 Solid tumours [525180]
Volitinib Drug Info Phase 2 Solid tumours [524739]
XL880 Drug Info Phase 2 Gastric cancer; Renal cell carcinoma; Squamous cell cancer of head and neck [541022], [550637]
BMS-777607 Drug Info Phase 1/2 Discovery agent [522210], [542869]
ChronSeal Drug Info Phase 1/2 Fibrosis [522498]
MK-2461 Drug Info Phase 1/2 Alzheimer disease [530708]
MSC2156119 Drug Info Phase 1/2 Cancer [524522]
Cabozantinib Drug Info Phase 1b Thyroid cancer; Renal cell carcinoma [541185], [550636]
ABT-700 Drug Info Phase 1 Advanced solid tumor [523689]
Altiratinib Drug Info Phase 1 Solid tumours [549538]
E-7050 Drug Info Phase 1 Head and neck cancer [525301], [542872]
EMD-1204831 Drug Info Phase 1 Solid tumours [523018]
EMD-1214063 Drug Info Phase 1 Solid tumours [522858], [543046]
Hepapoietin Drug Info Phase 1 Liver disease [526279]
JNJ-38877605 Drug Info Phase 1 Solid tumours [522280]
LY3164530 Drug Info Phase 1 Advanced cancers [889401]
Merestinib, LY2801653 Drug Info Phase 1 Cancer [551094]
MGCD516 Drug Info Phase 1 Solid tumours [524880]
MK-8033 Drug Info Phase 1 Solid tumours [522158]
PF-4217903 Drug Info Phase 1 Cancer [522363]
SGX523 Drug Info Phase 1 Solid tumours [522216], [541048]
XL880 Drug Info Phase 1 Solid tumours [541022], [550637]
Mteron-F1 Drug Info Preclinical Chemotherapy-induced mucositis [536838]
Inhibitor 1-(2-nitrophenethyl)-1H-pyrrolo[3,2-b]pyridine Drug Info [530081]
1-(phenylsulfonyl)-1H-pyrrolo[3,2-b]pyridine Drug Info [530081]
1-benzyl-1H-pyrrolo[3,2-b]pyridine Drug Info [530081]
3-(phenylsulfonyl)-1H-pyrrolo[2,3-b]pyridine Drug Info [530081]
Altiratinib Drug Info [550598]
AM7 Drug Info [529195]
Anti-cMET mab Drug Info [543501]
APS-3010 Drug Info [543501]
BAY-85-3474 Drug Info [543501]
BMS-536924 Drug Info [527711]
BMS-777607 Drug Info [529996]
C-Met kinase inhibitors Drug Info [543501]
Cabozantinib Drug Info [550636]
ChronSeal Drug Info [551075]
CMET Avimer polypeptides Drug Info [543501]
compound 16 Drug Info [529760]
compound 1o Drug Info [532542]
compound 27 Drug Info [531279]
compound R-16 Drug Info [531645]
DP-3590 Drug Info [543501]
EMD-1204831 Drug Info [549717]
Hepapoietin Drug Info [550038]
HM-5016504 Drug Info [543501]
JNJ-38877605 Drug Info [533168]
MG-516 Drug Info [543501]
MGCD516 Drug Info [531337]
MK-2461 Drug Info [530708]
MK-8033 Drug Info [549718]
MSC2156119 Drug Info [533163]
PF-00614435 Drug Info [543501]
PF-4217903 Drug Info [531829]
PHA-665752 Drug Info [543501]
PRS-110 Drug Info [543501]
RP-1040 Drug Info [543501]
SAR-125844 Drug Info [533073]
SGX523 Drug Info [550543]
SU11274 Drug Info [526884]
Tivantinib Drug Info [542863]
TP-801 Drug Info [543501]
Modulator ABT-700 Drug Info [549696]
AMG 208 Drug Info [533283]
AMG 337 Drug Info [549689]
Beperminogene perplasmid Drug Info [532942]
Crizotinib Drug Info [551871]
E-7050 Drug Info [530452]
EMD-1214063 Drug Info [532293]
GE-137 Drug Info [533287]
INCB28060 Drug Info [550454]
LY2801653 Drug Info [532170], [551095]
LY3164530 Drug Info [889442]
Merestinib, LY2801653 Drug Info [531996]
RG3638 Drug Info [543501]
Volitinib Drug Info [550990]
XL880 Drug Info [1572591]
Stimulator Mteron-F1 Drug Info [536838]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Malaria
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Melanoma
Central carbon metabolism in cancer
Pathway Interaction Database Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met)
Arf6 signaling events
Signaling events mediated by TCPTP
Posttranslational regulation of adherens junction stability and dissassembly
Direct p53 effectors
Syndecan-1-mediated signaling events
Stabilization and expansion of the E-cadherin adherens junction
a6b1 and a6b4 Integrin signaling
FGF signaling pathway
Regulation of retinoblastoma protein
Reactome Sema4D mediated inhibition of cell attachment and migration
WikiPathways TGF beta Signaling Pathway
Signaling of Hepatocyte Growth Factor Receptor
Focal Adhesion
Extracellular vesicle-mediated signaling in recipient cells
Signaling Pathways in Glioblastoma
miR-targeted genes in squamous cell - TarBase
miR-targeted genes in muscle cell - TarBase
miR-targeted genes in lymphocytes - TarBase
miR-targeted genes in epithelium - TarBase
Semaphorin interactions
References
Ref 468091(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4903).
Ref 522158ClinicalTrials.gov (NCT00559182) A Study of MK-8033 in Patients With Advanced Solid Tumors (MK-8033-001). U.S. National Institutes of Health.
Ref 522210ClinicalTrials.gov (NCT00605618) Multiple Ascending Dose Study of BMS-777607 in Subjects With Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health.
Ref 522216ClinicalTrials.gov (NCT00607399) Safety Study of SGX523, a Small Molecule Met Inhibitor, to Treat Solid Tumors. U.S. National Institutes of Health.
Ref 522280ClinicalTrials.gov (NCT00651365) A Safety and Dose-finding Study of JNJ-38877605 in Patients With Advanced or Refractory Solid Tumors.. U.S. National Institutes of Health.
Ref 522363ClinicalTrials.gov (NCT00706355) A Study of PF-04217903 in Patients With Advanced Cancer. U.S. National Institutes of Health.
Ref 522498ClinicalTrials.gov (NCT00797706) Phase I/II Dose Ranging CHRONSEAL Study in Venous Leg Ulcers. U.S. National Institutes of Health.
Ref 522858ClinicalTrials.gov (NCT01014936) First-in-Man, Dose-escalation Trial of C-met Kinase Inhibitor MSC2156119J in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health.
Ref 523018ClinicalTrials.gov (NCT01110083) First-in-Man, Dose-escalation Trial of c-Met Kinase Inhibitor EMD 1204831 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health.
Ref 523337ClinicalTrials.gov (NCT01285037) A Study of LY2801653 in Advanced Cancer. U.S. National Institutes of Health.
Ref 523689ClinicalTrials.gov (NCT01472016) Study of ABT-700 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health.
Ref 524369ClinicalTrials.gov (NCT01900652) A Study of LY2875358 in Non Small Cell Lung Cancer (NSCLC) Participants. U.S. National Institutes of Health.
Ref 524522ClinicalTrials.gov (NCT01982955) MSC2156119J With Gefitinib in Subjects With Advanced Non-small Cell Lung Cancer. U.S. National Institutes of Health.
Ref 524576ClinicalTrials.gov (NCT02016534) Phase 2 Study of AMG 337 in MET Amplified Gastric/Esophageal Adenocarcinoma or Other Solid Tumors. U.S. National Institutes of Health.
Ref 524739ClinicalTrials.gov (NCT02127710) A Phase II Trial to Evaluate the Efficacy of AZD6094 (HMPL-504) in Patients With Papillary Renal Cell Carcinoma (PRCC). U.S. National Institutes of Health.
Ref 524769ClinicalTrials.gov (NCT02144610) Safety and Efficacy of Subjects With Critical Limb Ischemia. U.S. National Institutes of Health.
Ref 524880ClinicalTrials.gov (NCT02219711) Phase 1/1b Study of MGCD516 in Patients With Advanced Cancer. U.S. National Institutes of Health.
Ref 525156ClinicalTrials.gov (NCT02420587) AMG 208 Tumor Microenvironment in Metastatic Castration Resistant Prostate Cancer (mCRPC). U.S. National Institutes of Health.
Ref 525180ClinicalTrials.gov (NCT02435121) A Study Assessing Efficacy and Safety of SAR125844 in NSCLC Patients With MET Amplification. U.S. National Institutes of Health.
Ref 525252ClinicalTrials.gov (NCT02488330) An Extension Study of Onartuzumab in Patients With Solid Tumors on Study Treatment Previously Enrolled in a Company Sponsored Study.
Ref 525301ClinicalTrials.gov (NCT02533102) Pharmacokinetics and Food Effect of Single Oral Dose of E7050 in Healthy Volunteers.
Ref 526279Pharmacokinetics and biochemical effects of hepapoietin in patients with chronic liver disease. Aliment Pharmacol Ther. 2002 Feb;16(2):235-42.
Ref 530708MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33.
Ref 5317832011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
Ref 532586A phase II trial of a selective c-Met inhibitor tivantinib (ARQ 197) monotherapy as a second- or third-line therapy in the patients with metastatic gastric cancer. Invest New Drugs. 2014 Apr;32(2):355-61.
Ref 536838Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.
Ref 541022(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5679).
Ref 541048(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5709).
Ref 541185(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5887).
Ref 542863(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7948).
Ref 542869(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7953).
Ref 542872(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7956).
Ref 543046(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8293).
Ref 549049Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031741)
Ref 549538Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040094)
Ref 550636Clinical pipeline report, company report or official report of Exelixis (2011).
Ref 550637Clinical pipeline report, company report or official report of Exelixis (2011).
Ref 551094Clinical pipeline report, company report or official report of Eli Lilly.
Ref 889401ClinicalTrials.gov (NCT02221882) A Study of LY3164530 in Participants With Cancer
Ref
Ref 526884Potent and selective inhibitors of the Met [hepatocyte growth factor/scatter factor (HGF/SF) receptor] tyrosine kinase block HGF/SF-induced tumor cell growth and invasion. Mol Cancer Ther. 2003 Nov;2(11):1085-92.
Ref 527711J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity.
Ref 529195c-Met inhibitors with novel binding mode show activity against several hereditary papillary renal cell carcinoma-related mutations. J Biol Chem. 2008 Feb 1;283(5):2675-83. Epub 2007 Nov 30.
Ref 529760Pyrrolo-pyrimidones: a novel class of MK2 inhibitors with potent cellular activity. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6142-6.
Ref 529996J Med Chem. 2009 Mar 12;52(5):1251-4.Discovery of N-(4-(2-amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl)-2-oxo-1,2-dihydropyridine-3-carboxamide (BMS-777607), a selective and orally efficacious inhibitor of the Met kinase superfamily.
Ref 530081Bioorg Med Chem Lett. 2009 May 15;19(10):2780-4. Epub 2009 Mar 27.Discovery of 4-azaindoles as novel inhibitors of c-Met kinase.
Ref 530452E7050: a dual c-Met and VEGFR-2 tyrosine kinase inhibitor promotes tumor regression and prolongs survival in mouse xenograft models. Cancer Sci. 2010 Jan;101(1):210-5.
Ref 530708MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33.
Ref 531279Fused bicyclic derivatives of 2,4-diaminopyrimidine as c-Met inhibitors. Bioorg Med Chem Lett. 2011 Jan 1;21(1):164-7.
Ref 531337Role and relevance of TrkB mutations and expression in non-small cell lung cancer. Clin Cancer Res. 2011 May 1;17(9):2638-45.
Ref 531645Improvement in oral bioavailability of 2,4-diaminopyrimidine c-Met inhibitors by incorporation of a 3-amidobenzazepin-2-one group. Bioorg Med Chem. 2011 Nov 1;19(21):6274-84.
Ref 531829Sensitivity of selected human tumor models to PF-04217903, a novel selective c-Met kinase inhibitor. Mol Cancer Ther. 2012 Apr;11(4):1036-47.
Ref 531996The c-Met inhibitors: a new class of drugs in the battle against advanced nonsmall-cell lung cancer. Curr Pharm Des. 2012;18(37):6155-68.
Ref 532170LY2801653 is an orally bioavailable multi-kinase inhibitor with potent activity against MET, MST1R, and other oncoproteins, and displays anti-tumor activities in mouse xenograft models. Invest New Drugs. 2013 Aug;31(4):833-44.
Ref 532293EMD 1214063 and EMD 1204831 constitute a new class of potent and highly selective c-Met inhibitors. Clin Cancer Res. 2013 Jun 1;19(11):2941-51.
Ref 532542Design and synthesis of novel 3-(benzo[d]oxazol-2-yl)-5-(1-(piperidin-4-yl)-1H-pyrazol-4-yl)pyridin-2-amine derivatives as selective G-protein-coupled receptor kinase-2 and -5 inhibitors. Bioorg Med Chem Lett. 2013 Dec 15;23(24):6711-6.
Ref 532942Beperminogene perplasmid for the treatment of critical limb ischemia. Expert Rev Cardiovasc Ther. 2014 Oct;12(10):1145-56.
Ref 532965LY2875358, a neutralizing and internalizing anti-MET bivalent antibody, inhibits HGF-dependent and HGF-independent MET activation and tumor growth. Clin Cancer Res. 2014 Dec 1;20(23):6059-70.
Ref 533073The selective intravenous inhibitor of the MET tyrosine kinase SAR125844 inhibits tumor growth in MET-amplified cancer. Mol Cancer Ther. 2015 Feb;14(2):384-94.
Ref 533163Identification and optimization of pyridazinones as potent and selective c-Met kinase inhibitors. Bioorg Med Chem Lett. 2015 Apr 1;25(7):1597-602.
Ref 533168The c-Met Tyrosine Kinase Inhibitor JNJ-38877605 Causes Renal Toxicity through Species-Specific Insoluble Metabolite Formation. Clin Cancer Res. 2015 May 15;21(10):2297-304.
Ref 533283A first-in-human study of AMG 208, an oral MET inhibitor, in adult patients with advanced solid tumors. Oncotarget. 2015 Jul 30;6(21):18693-706.
Ref 533287Detection of colorectal polyps in humans using an intravenously administered fluorescent peptide targeted against c-Met. Nat Med. 2015 Aug;21(8):955-61.
Ref 536838Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.
Ref 542863(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7948).
Ref 543501(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1815).
Ref 549689J Clin Oncol 32:5s, 2014 (suppl; abstr 2508).
Ref 549696J Clin Oncol 32:5s, 2014 (suppl; abstr 2507).
Ref 5497172012 ASCO Annual Meeting.
Ref 549718A novel c-Met inhibitor, MK8033, synergizes with carboplatin plus paclitaxel to inhibit ovarian cancer cell growth. Oncol Rep. 2013 May;29(5):2011-8.
Ref 550038Pharmacokinetics and biochemical effects of hepapoietin in patients with chronic liver disease. Alimentary Pharmacology & Therapeutics Volume 16, Issue 2, pages 235-242, February 2002.
Ref 550454National Cancer Institute Drug Dictionary (drug id 666907).
Ref 550543CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008.
Ref 550598Clinical pipeline report, company report or official report of Deciphera Pharmaceuticals.
Ref 550636Clinical pipeline report, company report or official report of Exelixis (2011).
Ref 550990Clinical pipeline report, company report or official report of Hutchison Medi Pharma.
Ref 551075Clinical pipeline report, company report or official report of Kringle Pharma.
Ref 551093Clinical pipeline report, company report or official report of Eli Lilly.
Ref 551095Clinical pipeline report, company report or official report of Eli Lilly.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 889442Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.