Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T57011
|
||||
Former ID |
TTDC00192
|
||||
Target Name |
mRNA of Intercellularadhesion molecule-1
|
||||
Gene Name |
ICAM1
|
||||
Synonyms |
CD54 antigen; ICAM-1; Major group rhinovirus receptor; ICAM1
|
||||
Target Type |
Successful
|
||||
Disease | Crohn's disease; Ulcerative colitis [ICD9: 555, 556, 556.9; ICD10: K50, K50-K52, K51] | ||||
Pouchitis [ICD10: K91.8] | |||||
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
Function |
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans- endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
|
||||
BioChemical Class |
Target of antisense drug
|
||||
Target Validation |
T57011
|
||||
UniProt ID | |||||
Sequence |
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | NF-kappa B signaling pathway | ||||
Cell adhesion molecules (CAMs) | |||||
Natural killer cell mediated cytotoxicity | |||||
TNF signaling pathway | |||||
Leukocyte transendothelial migration | |||||
African trypanosomiasis | |||||
Malaria | |||||
Staphylococcus aureus infection | |||||
Influenza A | |||||
HTLV-I infection | |||||
Epstein-Barr virus infection | |||||
Rheumatoid arthritis | |||||
Viral myocarditis | |||||
NetPath Pathway | IL5 Signaling Pathway | ||||
IL1 Signaling Pathway | |||||
TSH Signaling Pathway | |||||
IL6 Signaling Pathway | |||||
IL2 Signaling Pathway | |||||
ID Signaling Pathway | |||||
TWEAK Signaling Pathway | |||||
RANKL Signaling Pathway | |||||
TNFalpha Signaling Pathway | |||||
Pathway Interaction Database | Thromboxane A2 receptor signaling | ||||
Glucocorticoid receptor regulatory network | |||||
amb2 Integrin signaling | |||||
Beta2 integrin cell surface interactions | |||||
Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
Integrin cell surface interactions | |||||
Interferon gamma signaling | |||||
WikiPathways | Type II interferon signaling (IFNG) | ||||
IL1 and megakaryotyces in obesity | |||||
Human Complement System | |||||
Spinal Cord Injury | |||||
Interleukin-11 Signaling Pathway | |||||
RANKL/RANK Signaling Pathway | |||||
Integrin cell surface interactions | |||||
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
Folate Metabolism | |||||
Vitamin B12 Metabolism | |||||
Selenium Micronutrient Network | |||||
References | |||||
Ref 529623 | Bioorg Med Chem Lett. 2008 Aug 15;18(16):4544-6. Epub 2008 Jul 15.Alkamides from the fruits of Piper longum and Piper nigrum displaying potent cell adhesion inhibition. | ||||
Ref 531049 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5269-73. Epub 2010 Jul 23.Discovery of tetrahydroisoquinoline (THIQ) derivatives as potent and orally bioavailable LFA-1/ICAM-1 antagonists. | ||||
Ref 549600 | US patent application no. 5,789,573, Antisense inhibition of ICAM-1, E-selectin, and CMV IE1/IE2. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.