Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T30081
|
||||
| Former ID |
TTDR00500
|
||||
| Target Name |
Thymidine kinase
|
||||
| Gene Name |
TK1
|
||||
| Synonyms |
TK; TK1
|
||||
| Target Type |
Successful
|
||||
| Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
| Adult varicella zoster virus infection [ICD10: B02] | |||||
| Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Graft-versus-host disease [ICD9: 279.5; ICD10: T86.0] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Phosphorylates both thymidine and deoxyuridine.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T30081
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.1.21
|
||||
| Sequence |
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | DEOXYCYTIDINE | Drug Info | Approved | Acute myeloid leukemia | [544766], [551871] |
| TK-DLI | Drug Info | Preregistration | Graft-versus-host disease | [548206] | |
| FV-100 | Drug Info | Phase 3 | Adult varicella zoster virus infection | [525145] | |
| Radiosensitizer gene therapy | Drug Info | Phase 3 | Pancreatic cancer | [550209] | |
| HQK-1004 | Drug Info | Phase 2 | Solid tumours | [522815] | |
| Ad-OC-hsvTK/valacyclovir | Drug Info | Phase 1 | Prostate cancer | [546377] | |
| Thymidine kinase-expressing adenovirus and ganciclovir suicide gene therapy | Drug Info | Phase 1 | Cancer | [522769] | |
| Sitimagene ceradenovec | Drug Info | Discontinued in Phase 3 | Brain cancer | [547335] | |
| Inhibitor | (South)-Methanocarba-Thymidine | Drug Info | [551393] | ||
| 1-[(Z)-4-(triphenylmethoxy)-2-butenyl]thymine | Drug Info | [528583] | |||
| 1-[2-(2-triphenylmethoxyethoxy)ethyl]thymine | Drug Info | [528583] | |||
| 1-[5-(triphenylmethoxy)pentyl]thymine | Drug Info | [528583] | |||
| 1-[6-(triphenylmethoxy)hexyl]thymine | Drug Info | [528583] | |||
| 1-[7-(triphenylmethoxy)heptyl]thymine | Drug Info | [528583] | |||
| 2-phenylamino-9-(4-hydroxy-butyl)-6-oxopurine | Drug Info | [528791] | |||
| 3'-(1,2,3-Triazol-1-yl)-3'-deoxy-beta-D-thymidine | Drug Info | [530778] | |||
| 3-(2-propyn-1-yl)thymidine | Drug Info | [529740] | |||
| 5-Bromothienyldeoxyuridine | Drug Info | [551393] | |||
| 5-Bromovinyldeoxyuridine | Drug Info | [551391] | |||
| 5-Iodo-2'-Deoxyuridine-5'-Monophosphate | Drug Info | [551393] | |||
| 5-Iododeoxyuridine | Drug Info | [551393] | |||
| 5-propyl-2'-deoxyuridine | Drug Info | [528791] | |||
| 6-(Dihydroxy-Isobutyl)-Thymine | Drug Info | [551393] | |||
| 6-Hydroxypropylthymine | Drug Info | [551393] | |||
| 9-(4-Hydroxy-3-(Hydroxymethyl)but-1-Yl)Guanine | Drug Info | [551393] | |||
| 9-(4-Hydroxybutyl)-N2-Phenylguanine | Drug Info | [551393] | |||
| 9-Hydroxypropyladenine, R-Isomer | Drug Info | [551393] | |||
| 9-Hydroxypropyladenine, S-Isomer | Drug Info | [551393] | |||
| Ad-OC-hsvTK/valacyclovir | Drug Info | [526573] | |||
| Adenosine-5'-Diphosphate | Drug Info | [551391] | |||
| BVDU-MP | Drug Info | [551375] | |||
| DEOXYCYTIDINE | Drug Info | [533569] | |||
| Deoxythymidine | Drug Info | [551393] | |||
| DEOXYURIDINE | Drug Info | [533569] | |||
| Edoxudine | Drug Info | [528791] | |||
| FV-100 | Drug Info | [526256] | |||
| ITdU | Drug Info | [538114] | |||
| L-5-(bromovinyl)deoxyuridine | Drug Info | [528791] | |||
| L-5-iodo-2'-deoxyuridine | Drug Info | [528791] | |||
| MTdU | Drug Info | [538114] | |||
| N2-(3-trifluoromethylphenyl)guanine | Drug Info | [528791] | |||
| P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate | Drug Info | [551391] | |||
| Radiosensitizer gene therapy | Drug Info | [534746] | |||
| Thymidine-5'-Phosphate | Drug Info | [551393] | |||
| Thymidine-5'-Triphosphate | Drug Info | [551393] | |||
| Modulator | HQK-1004 | Drug Info | [526142] | ||
| Sitimagene ceradenovec | Drug Info | [531287] | |||
| Thymidine kinase-expressing adenovirus and ganciclovir suicide gene therapy | Drug Info | [1572591] | |||
| TK-DLI | Drug Info | ||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 522769 | ClinicalTrials.gov (NCT00964756) A Study of an Infectivity Enhanced Suicide Gene Expressing Adenovirus for Ovarian Cancer in Patients With Recurrent Ovarian and Other Selected Gynecologic Cancers. U.S. National Institutes of Health. | ||||
| Ref 522815 | ClinicalTrials.gov (NCT00992732) Study of HQK-1004 and Valganciclovir to Treat Epstein-Barr Virus (EBV) - Positive Lymphoid Malignancies or Lymphoproliferative Disorders. U.S. National Institutes of Health. | ||||
| Ref 525145 | ClinicalTrials.gov (NCT02412917) A Comparative Study of FV-100 vs. Valacyclovir for the Prevention of Post-Herpetic Neuralgia. U.S. National Institutes of Health. | ||||
| Ref 544766 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000912) | ||||
| Ref 546377 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007778) | ||||
| Ref 547335 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015264) | ||||
| Ref 526142 | Induction of the Epstein-Barr virus thymidine kinase gene with concomitant nucleoside antivirals as a therapeutic strategy for Epstein-Barr virus-associated malignancies. Curr Opin Oncol. 2001 Sep;13(5):360-7. | ||||
| Ref 526256 | Specific recognition of the bicyclic pyrimidine nucleoside analogs, a new class of highly potent and selective inhibitors of varicella-zoster virus (VZV), by the VZV-encoded thymidine kinase. Mol Pharmacol. 2002 Feb;61(2):249-54. | ||||
| Ref 526573 | Phase I dose escalation clinical trial of adenovirus vector carrying osteocalcin promoter-driven herpes simplex virus thymidine kinase in localized and metastatic hormone-refractory prostate cancer. Hum Gene Ther. 2003 Feb 10;14(3):227-41. | ||||
| Ref 528583 | J Med Chem. 2006 Dec 28;49(26):7766-73.N1-substituted thymine derivatives as mitochondrial thymidine kinase (TK-2) inhibitors. | ||||
| Ref 528791 | Antimicrob Agents Chemother. 2007 Jun;51(6):2028-34. Epub 2007 Apr 16.Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs: role of thymidine kinase in antiviral activities of substrate analogs and acyclonucleosides. | ||||
| Ref 529740 | J Med Chem. 2008 Nov 13;51(21):6689-98. Epub 2008 Oct 7.Synthesis, in vitro, and in silico evaluation of organometallic technetium and rhenium thymidine complexes with retained substrate activity toward human thymidine kinase type 1. | ||||
| Ref 530778 | J Med Chem. 2010 Apr 8;53(7):2902-12.3'-[4-Aryl-(1,2,3-triazol-1-yl)]-3'-deoxythymidine analogues as potent and selective inhibitors of human mitochondrial thymidine kinase. | ||||
| Ref 531287 | Sitimagene ceradenovec: a gene-based drug for the treatment of operable high-grade glioma. Future Oncol. 2010 Nov;6(11):1691-710. | ||||
| Ref 533569 | J Med Chem. 1982 Jun;25(6):644-9.Species- or isozyme-specific enzyme inhibitors. 5. Differential effects of thymidine substituents on affinity for rat thymidine kinase isozymes. | ||||
| Ref 534746 | Pronounced antitumor effects and tumor radiosensitization of double suicide gene therapy. Clin Cancer Res. 1997 Nov;3(11):2081-8. | ||||
| Ref 538114 | Trichomonas vaginalis thymidine kinase: purification, characterization and search for inhibitors. Biochem J. 1998 Aug 15;334 ( Pt 1):15-22. | ||||
| Ref 551375 | Crystal structure of varicella zoster virus thymidine kinase. J Biol Chem. 2003 Jul 4;278(27):24680-7. Epub 2003 Apr 9. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.