Resistance mutation info of target
| Target General Information | |||||
|---|---|---|---|---|---|
| Target ID | T52227 | ||||
| Target Name | Bacterial Thymidylate synthase (thyA) | Target Info | |||
| Gene Name | thyA | ||||
| Species | Mycobacterium tuberculosis | ||||
| Uniprot ID | TYSY_MYCTU | ||||
| Sequence | MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE YTYEDIVVKNYDPHPAIKAPVAV [Mycobacterium tuberculosis] |
||||
| Drug Resistance Mutation and Corresponding Drugs | |||||
| Mutation Info | Missense: R222G | ||||
| Mutation Info | Missense: T202A | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.