Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T97174
|
||||
| Former ID |
TTDS00481
|
||||
| Target Name |
Mannose-6-phosphate receptor
|
||||
| Gene Name |
M6PR
|
||||
| Synonyms |
46kDa mannose 6-phosphate receptor; CD-MPR; CDMan-6-P receptor; MPR 46; MPR46; MPRD; M6PR
|
||||
| Target Type |
Successful
|
||||
| Disease | Pompe's disease; Type 2 glycogen storage disease [ICD9:271; ICD10: E74.02, E74.0] | ||||
| Function |
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6- phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex.
|
||||
| UniProt ID | |||||
| Sequence |
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
ESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIML IYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS PEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGC DFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.