Target General Infomation
Target ID
T67162
Former ID
TTDS00012
Target Name
D(2) dopamine receptor
Gene Name
DRD2
Synonyms
Dopamine D2 receptor; Dopamine receptor 2; DRD2
Target Type
Successful
Disease Alcohol use disorders [ICD9: 303; ICD10: F10.2]
Allergy [ICD9: 995.3; ICD10: T78.4]
Asthma; Bronchitis [ICD9: 466, 490, 491, 493; ICD10: J20-J21, J42, J45]
Alzheimer disease [ICD9: 331; ICD10: G30]
Advanced stage Parkinson's disease [ICD9: 332; ICD10: F02.3, G20]
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42]
Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42]
Bipolar disorder; Schizophrenia [ICD9:296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300, 295; ICD10: F31, F40-F42, F20]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Cardiac failure [ICD10: I50]
Cardiotonic [ICD10: I50]
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63]
Carcinoid syndrome; Acromegaly [ICD9:253; ICD10: E34.0, E22.0]
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47]
Corneal vascularity; Hyperaemia; Itching [ICD10: L29]
Depressive fatigue [ICD9: 780.71; ICD10: R53.82]
Dermal necrosis [ICD10: K05]
Emesis [ICD9: 787; ICD10: R11]
Fibrosis [ICD9: 709.2; ICD10: L90.5]
False perceptions; Bipolar disorder [ICD9:297, 780.1, 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F22, R44, F31, F40-F42]
Gastrointestinal problems [ICD9: 536, 750; ICD10: K30-K31, Q40-Q41]
Glaucoma [ICD9: 365; ICD10: H40-H42]
Hypotension [ICD9: 458, 796.3; ICD10: I95]
Hypertension [ICD9: 401; ICD10: I10-I16]
Hyperprolactinemia [ICD9: 253.1; ICD10: E22.1]
Heart failure [ICD9: 428; ICD10: I50]
Hypertension; Angina pectoris [ICD9:401, 413; ICD10: I10-I16, I20]
Huntington's disease [ICD9: 294.1, 333.4; ICD10: F02.2, G10]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
Idiopathic thrombocytopenic purpura [ICD9: 287.31; ICD10: D69.3]
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0]
Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension [ICD10: N40, C61]
Migraine headaches [ICD9: 346; ICD10: G43]
Maintain blood pressure in hypotensive states [ICD10: I10]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Nasal congestion [ICD9: 478.19; ICD10: J34.89]
Non-small cell lung cancer [ICD10: C33-C34]
Nausea; Vomiting [ICD9: 787, 787.0; ICD10: R11]
Ophthalmic disease [ICD10: H00-H59]
Peripheral vasoconstriction; Pulmonary hypertension [ICD9:443, 416; ICD10: I73, I27.0, I27.2]
Postpartum haemorrhage [ICD9: 666; ICD10: O72]
Psychosis [ICD10: F20-F29]
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29]
Pain; Inflammatory diseases [ICD9: 338,780; ICD10: R52, G89]
Parkinson's disease; Restless legs syndrome [ICD9: 332, 333.94; ICD10: F02.3, G20, G25.8]
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99]
Parkinson's disease [ICD9: 332; ICD10: G20]
Schizophrenia; Bipolar disorder [ICD9: 295, 296; ICD10: F20, F31]
Schizophrenia; Schizoaffective disorders [ICD9: 295, 295.70; ICD10: F20, F25]
Substance dependence [ICD10: F10-F19]
Schizoaffective disorder; Schizophrenia [ICD9: 295, 295.70; ICD10: F20, F25]
Sexual dysfunction [ICD9: 302.7; ICD10: F52]
Schizophrenia [ICD9: 295; ICD10: F20]
Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
BioChemical Class
GPCR rhodopsin
Target Validation
T67162
UniProt ID
Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Structure
1I15; 2YOU
Drugs and Mode of Action
Drug(s) Acetophenazine Drug Info Approved False perceptions; Bipolar disorder [538457], [551871]
Amisulpride Drug Info Approved Schizophrenia [536361], [543330]
Aniracetam Drug Info Approved Cerebrovascular ischaemia [467478], [526084]
Apomorphine Drug Info Approved Parkinson's disease [525056], [540260]
Aripiprazole Drug Info Approved Schizophrenia [537632], [540346]
Bevantolol Drug Info Approved Hypertension; Angina pectoris [536361], [551871]
Bromocriptine Drug Info Approved Parkinson's disease [536285], [540438]
Cabergoline Drug Info Approved Hyperprolactinemia [536285], [540505]
Cariprazine Drug Info Approved Bipolar disorder [532651], [542650]
Carphenazine Drug Info Approved Insomnia [551871]
Chlorpromazine Drug Info Approved Schizophrenia [538339], [543051]
Chlorprothixene Drug Info Approved Psychotic disorders [538474]
Dapiprazole Drug Info Approved Glaucoma [551871]
Denopamine Drug Info Approved Cardiotonic [540779], [551871]
Dihydroergotamine Drug Info Approved Migraine headaches [537885], [538723]
Dihydroergotoxine Drug Info Approved Alzheimer disease [534844]
Docarpamine Drug Info Approved Hypertension [551871]
Domperidone Drug Info Approved Gastrointestinal problems [536732], [543331]
Dopamine Drug Info Approved Parkinson's disease [536463], [543313]
Dopexamine Drug Info Approved Cardiac failure [551871]
Droperidol Drug Info Approved Nausea; Vomiting [538243], [542182]
Ephedrine Drug Info Approved Asthma; Bronchitis [536322], [540937]
Ergonovine Drug Info Approved Postpartum haemorrhage [538389], [538934]
Fluspirilene Drug Info Approved Schizophrenia [543173], [550728]
Haloperidol Drug Info Approved Schizophrenia [536361], [543216]
Ibopamine hci Drug Info Approved Cardiotonic [551871]
Iloperidone Drug Info Approved Schizophrenia [530677], [543255]
Levodopa Drug Info Approved Parkinson's disease [540492]
Levomepromazine Drug Info Approved Psychosis [551871]
Lisuride Drug Info Approved Parkinson's disease [467639], [536217]
Loxapine Drug Info Approved Schizophrenia [551871]
Lurasidone hydrochloride Drug Info Approved Schizophrenia [530859], [531351], [542486], [551871]
Mephentermine Drug Info Approved Maintain blood pressure in hypotensive states [551871]
Mesoridazine Drug Info Approved Schizophrenia [538478], [542242]
Metaraminol Drug Info Approved Hypotension [538343], [542244]
Methamfetamine Drug Info Approved Pain; Inflammatory diseases [536103]
Methyldopa Drug Info Approved Hypertension [468270], [538218]
Metoclopramide Drug Info Approved Nausea; Vomiting [538220], [539539]
Molindone Drug Info Approved Schizophrenia [538485], [539311]
N-0923 Drug Info Approved Parkinson's disease [528061], [529282]
Naphazoline Drug Info Approved Corneal vascularity; Hyperaemia; Itching [551871]
Nemonapride Drug Info Approved Schizophrenia [536463], [543347]
Olanzapine Drug Info Approved Schizophrenia [467939], [535119]
OPC-34712 Drug Info Approved Major depressive disorder [523551], [542651]
PD-172760 Drug Info Approved Schizophrenia [536463]
Perazine Drug Info Approved Psychotic disorders [551871]
Pergolide Drug Info Approved Parkinson's disease [468029], [536285]
Perphenazine Drug Info Approved Schizophrenia; Bipolar disorder [539323], [549998]
Phenoxybenzamine Drug Info Approved Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension [551871]
Phentolamine Drug Info Approved Dermal necrosis [468130], [538172]
Phenylephrine Drug Info Approved Ophthalmic disease [468078], [538192]
Phenyltoloxamine Drug Info Approved Allergy [551871]
Pimozide Drug Info Approved Schizophrenia [538488], [543290]
Piperacetazine Drug Info Approved Schizophrenia [551871]
Pramipexole Drug Info Approved Parkinson's disease [536580], [543322]
Prochlorperazine Drug Info Approved Nausea; Vomiting [538160], [542299]
Pseudoephedrine Drug Info Approved Nasal congestion [538291], [542306]
Quetiapine Drug Info Approved Schizophrenia [468121], [536773]
Quinagolide Drug Info Approved Hyperprolactinemia [536361]
Risperidone Drug Info Approved Schizophrenia [536526], [543327]
Ropinirole Drug Info Approved Parkinson's disease [537532], [542315]
Sulpiride Drug Info Approved Schizophrenia [537476], [543328]
Thiethylperazine Drug Info Approved Nausea; Vomiting [538460], [542328]
Thioridazine Drug Info Approved Schizophrenia [538368], [538609]
Thiothixene Drug Info Approved Schizophrenia [538226], [539343]
Tiapride Drug Info Approved Alcohol use disorders [551871]
Tolazoline Drug Info Approved Peripheral vasoconstriction; Pulmonary hypertension [538395], [542333], [551871]
Ziprasidone Drug Info Approved Schizophrenia [536526], [541192]
Zuclopenthixol Drug Info Approved Schizophrenia [542559], [550679]
Raclopride Drug Info Phase 4 Psychotic disorders [524579], [543312]
Talipexole Drug Info Phase 4 Discovery agent [524901], [540844]
Bis(olanzapine) pamoate monohydrate Drug Info Phase 3 Psychotic disorders [551871]
Blonanserin Drug Info Phase 3 Schizophrenia [536463], [542649]
CQA 206-291 Drug Info Phase 3 Parkinson's disease [531697]
Entacapone+levodopa+carbidopa Drug Info Phase 3 Parkinson's disease; Restless legs syndrome [544058]
Lisuride Drug Info Phase 3 Fibrosis [521931]
Pridopidine Drug Info Phase 3 Huntington's disease [522303]
RBP-7000 Drug Info Phase 3 Non-small cell lung cancer [524709]
Sumanirole Drug Info Phase 3 Parkinson's disease [536923], [540570]
Zicronapine Drug Info Phase 3 Schizophrenia [523357]
P2B-001 Drug Info Phase 2/3 Parkinson's disease [524487]
APD-403 Drug Info Phase 2 Emesis [524298]
Aplindore fumarate Drug Info Phase 2 Schizophrenia [536463]
BIM23A760 Drug Info Phase 2 Carcinoid syndrome; Acromegaly [528145], [536738]
BL-1020 Drug Info Phase 2 Schizophrenia [536463]
CGS-15873A Drug Info Phase 2 Psychotic disorders [544883]
CLR-3001 Drug Info Phase 2 Major depressive disorder [549113]
Intranasal apomorphine Drug Info Phase 2 Sexual dysfunction [527086]
JNJ-37822681 Drug Info Phase 2 Schizophrenia [522393]
Mazapertine succinate Drug Info Phase 2 Psychotic disorders [534644]
Ocaperidone Drug Info Phase 2 Schizophrenia; Schizoaffective disorders [467839], [526792], [536463]
Pardoprunox Drug Info Phase 2 Advanced stage Parkinson's disease [536580]
PD-143188 Drug Info Phase 2 Psychotic disorders [546028]
ROXINDOLE Drug Info Phase 2 Psychotic disorders [468254], [534084]
RP5063 Drug Info Phase 2 Schizoaffective disorder; Schizophrenia [523723]
SDZ-MAR-327 Drug Info Phase 2 Psychotic disorders [534772], [536463]
XP-21279 Drug Info Phase 2 Parkinson's disease [523123]
(-)-3PPP, Maryland Drug Info Phase 1 Schizophrenia [526776]
1192U90 Drug Info Phase 1 Psychotic disorders [534252]
Abaperidone Drug Info Phase 1 Schizophrenia [551815]
Carmoxirole Drug Info Phase 1 Hypertension [526775]
Dopamine Drug Info Phase 1 Hypotension [543313], [551871]
Lu-02-750 Drug Info Phase 1 Parkinson's disease [548985]
Lu-AE04621 Drug Info Phase 1 Parkinson's disease [549066]
SKL-10406 Drug Info Phase 1 Major depressive disorder [549136]
SSR-181507 Drug Info Phase 1 Schizophrenia [536463]
Umespirone Drug Info Phase 1 Anxiety disorder [544712]
YKP-1358 Drug Info Phase 1 Schizophrenia; Schizoaffective disorders [536463]
D1 agonist D2 antagonist Drug Info Preclinical Schizophrenia [536463]
F-15063 Drug Info Preclinical Schizophrenia [548528]
Org-23366 Drug Info Preclinical Schizophrenia [536463]
PD-157695 Drug Info Preclinical Schizophrenia [536463]
PD-158771 Drug Info Preclinical Schizophrenia [536463]
PGX-200097 Drug Info Preclinical Schizophrenia [548315]
S32504 Drug Info Preclinical Parkinson's disease [526972]
Carphenazine Drug Info Withdrawn from market Schizophrenia [542148], [550749]
Fencamfamine Drug Info Withdrawn from market Depressive fatigue [550709]
Flupenthixol Drug Info Withdrawn from market Schizophrenia [536814], [543333]
Nomifensine Drug Info Withdrawn from market Breast cancer [468021], [551871]
Remoxipride Drug Info Withdrawn from market Schizophrenia [526174]
Sertindole Drug Info Withdrawn from market Schizophrenia [528387], [543343]
(S)-amisulpride Drug Info Discontinued in Phase 4 Schizophrenia [536463]
Bifeprunox Drug Info Discontinued in Phase 3 Schizophrenia [536463]
Lamectacin Drug Info Discontinued in Phase 3 Bacterial infections [547323]
NOLOMIROLE HYDROCHLORIDE Drug Info Discontinued in Phase 3 Heart failure [545464]
Sibenadet Drug Info Discontinued in Phase 3 Chronic obstructive pulmonary disease [536661]
TIOSPIRONE Drug Info Discontinued in Phase 3 Discovery agent [538617], [544679]
ATI-9242 Drug Info Discontinued in Phase 2 Schizophrenia [548733]
BAM-1110 Drug Info Discontinued in Phase 2 Parkinson's disease [545888]
Declopramide Drug Info Discontinued in Phase 2 Inflammatory bowel disease [546239]
FOSOPAMINE Drug Info Discontinued in Phase 2 Hypertension [545255]
MAZAPERTINE Drug Info Discontinued in Phase 2 Discovery agent [545274]
Naxagolide Drug Info Discontinued in Phase 2 Parkinson's disease [545272]
PF-217830 Drug Info Discontinued in Phase 2 Bipolar disorder; Schizophrenia [548438]
Romergoline Drug Info Discontinued in Phase 2 Anxiety disorder [544873]
Sarizotan Drug Info Discontinued in Phase 2 Parkinson's disease [536923]
SAVOXEPIN MESYLATE Drug Info Discontinued in Phase 2 Psychotic disorders [544699]
SLV-310 Drug Info Discontinued in Phase 2 Schizophrenia [536463]
AM-831 Drug Info Discontinued in Phase 1 Schizophrenia [547459]
DU-29894 Drug Info Discontinued in Phase 1 Psychotic disorders [544888]
Ordopidine Drug Info Discontinued in Phase 1 Psychotic disorders [548392]
S-18327 Drug Info Discontinued in Phase 1 Psychotic disorders [546690]
SDZ-GLC-756 Drug Info Discontinued in Phase 1 Glaucoma [546521]
SLV-313 Drug Info Discontinued in Phase 1 Schizophrenia [536463]
1192U90 Drug Info Terminated Schizophrenia [536463]
A-80426 Drug Info Terminated Discovery agent [546043]
AMR-103 Drug Info Terminated Parkinson's disease [548466]
BIMG80 Drug Info Terminated Psychotic disorders [546146]
CGP-25454A Drug Info Terminated Major depressive disorder [545667]
CP-903397 Drug Info Terminated Schizophrenia [548436]
E-2040 Drug Info Terminated Schizophrenia [546598]
Etrabamine Drug Info Terminated Parkinson's disease [545467]
GMC-283 Drug Info Terminated Schizophrenia [536463]
HMR-2934 Drug Info Terminated Schizophrenia [536463]
LY-243062 Drug Info Terminated Inflammatory disease [545858]
NGD-93-1 Drug Info Terminated Psychotic disorders [545340]
NNC-22-0031 Drug Info Terminated Psychotic disorders [534327]
Org-10490 Drug Info Terminated Psychotic disorders [551630]
PD-128483 Drug Info Terminated Discovery agent [545125]
PNU-96391A Drug Info Terminated Substance dependence [532971]
RWJ-25730 Drug Info Terminated Psychotic disorders [544892]
S32504 Drug Info Terminated Major depressive disorder [547082]
SDZ-MAR-327 Drug Info Terminated Schizophrenia [536463]
SLV-307 Drug Info Terminated Parkinson's disease [551583]
Y-20024 Drug Info Terminated Psychotic disorders [544868]
Y-931 Drug Info Terminated Schizophrenia [536463]
ZD-3638 Drug Info Terminated Schizophrenia [536463]
Inhibitor (+)-(1R,1'S)-berbamunine hydrochloride Drug Info [551356]
(+)-(1R,1'S)-thaligrisine hydrochloride Drug Info [551356]
(+)-3-(1-Propyl-piperidin-3-yl)-phenol Drug Info [530310]
(+)-BUTACLAMOL Drug Info [527368]
(+/-)-7-hydroxy-2-(N,N-di-n-propylamino)tetralin Drug Info [529836]
(+/-)-nantenine Drug Info [530558]
(-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride Drug Info [551356]
(-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile Drug Info [533938]
(-)-5-hydroxy-2-(dipropylamino)tetralin Drug Info [530606]
(4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine Drug Info [525701]
(4-Quinolin-2-ylpiperazin-1-yl)acetic Acid Drug Info [530114]
(5-Methoxy-chroman-3-yl)-dipropyl-amine Drug Info [534244]
(R)-(+)-coclaurine Drug Info [534656]
(R)-(-)-10-methyl-11-hydroxyaporphine Drug Info [528876]
(R)-(-)-11-hydroxy-N-n-propylnoraporphine Drug Info [529289]
(R)-(-)-2-methoxy-11-hydroxyaporphine Drug Info [529289]
(R)-(-)-2-methoxy-N-npropylnorapomorphine Drug Info [529289]
(R)-(-)-2-Methyl-apomorphine hydrochloride Drug Info [529328]
(R)-(-)-2-Phenyl-apomorphine hydrochloride Drug Info [529328]
(R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine Drug Info [529289]
(R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine Drug Info [529289]
(S)-BULBOCAPNINE Drug Info [528616]
(S)-secoantioquine hydrochloride Drug Info [551356]
(S)APOMORPHINE Drug Info [530342]
(S,R)-antioquine hydrochloride Drug Info [551356]
(S,R)-isotetrandrine hydrochloride Drug Info [551356]
(S,R)-pseudoxandrine hydrochloride Drug Info [551356]
(S,S)-oxandrine hydrochloride Drug Info [551356]
1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol Drug Info [528616]
1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane Drug Info [529349]
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane Drug Info [530927]
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane Drug Info [530927]
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane Drug Info [530927]
1,6-bis(4-m-tolylpiperazin-1-yl)hexane Drug Info [530927]
1,6-bis(4-phenylpiperazin-1-yl)hexane Drug Info [530927]
1-(3-Hydroxyphenyl)-4-propylpiperazine Drug Info [530725]
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine Drug Info [528099]
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one Drug Info [528904]
1-(benzyloxy)-2-(2-phenylethyl)benzene Drug Info [528493]
1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene Drug Info [528493]
1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol Drug Info [529371]
1-Aminomethyl-isochroman-5,6-diol Drug Info [530404]
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-(3-hydroxyphenyl)piperidine Drug Info [530725]
1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine Drug Info [525629]
1-Benzyl-4-pyrrol-1-yl-piperidine Drug Info [525629]
1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperazine Drug Info [530725]
1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperidine Drug Info [530725]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine Drug Info [533570]
1-Methyl-1,2,3,4-tetrahydro-isoquinoline-6,7-diol Drug Info [551342]
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine Drug Info [551334]
1-Propyl-3-m-tolyl-piperidine hydrochloride Drug Info [526495]
1-Propyl-3-o-tolyl-piperidine hydrochloride Drug Info [526495]
1-Propyl-3-p-tolyl-piperidine hydrochloride Drug Info [526495]
1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene Drug Info [528493]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine Drug Info [527160]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine Drug Info [527160]
1-[3-(Methylsulfonyl)phenyl]-4-propylpiperazine Drug Info [530725]
2,3-Dihydro-1H-indol-5-ol Drug Info [551342]
2-(4-Dipropylamino-cyclohexylidene)-malononitrile Drug Info [525701]
2-methoxyapomorphine Drug Info [529349]
2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline Drug Info [533578]
2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine Drug Info [528493]
2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol Drug Info [529349]
3,8-dibromoboldine Drug Info [525759]
3-(1-Propyl-pyrrolidin-3-yl)-phenol Drug Info [551334]
3-(2,3-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(2,3-Dimethyl-phenyl)-piperidine Drug Info [534764]
3-(2,4-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(2,5-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(2,6-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(2-Benzylamino-ethoxy)-phenol Drug Info [525599]
3-(3,4-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(3,4-Dimethyl-phenyl)-piperidine Drug Info [534764]
3-(3,5-Dimethyl-phenyl)-1-propyl-piperidine Drug Info [534764]
3-(3,5-Dimethyl-phenyl)-piperidine Drug Info [534764]
3-(4-Benzyl-piperazin-1-yl)-phenol Drug Info [534802]
3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one Drug Info [527368]
3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole Drug Info [534131]
3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole Drug Info [534131]
3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole Drug Info [534131]
3-(N-propylpiperidin-4-yl)phenol Drug Info [530725]
3-(Octahydro-indolizin-8-yl)-phenol Drug Info [530318]
3-(Octahydro-quinolizin-1-yl)-phenol Drug Info [530318]
3-(Octahydro-quinolizin-3-yl)-phenol Drug Info [530318]
3-bromoboldine Drug Info [525759]
3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol Drug Info [526822]
3-Chloroboldine Drug Info [525759]
3-Cyclohexyl-1-propyl-piperidine hydrochloride Drug Info [526495]
3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol Drug Info [526822]
3-Iodoboldine Drug Info [525759]
3-Naphthalen-1-yl-1-propyl-pyrrolidine Drug Info [551334]
3-Naphthalen-1-yl-pyrrolidine Drug Info [551334]
3-Phenyl-1-propyl-piperidine hydrochloride Drug Info [526495]
3-Phenyl-1-propyl-pyrrolidine Drug Info [551334]
3-Phenyl-pyrrolidine Drug Info [551334]
3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine Drug Info [528493]
4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one Drug Info [525599]
4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-1H-indole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole Drug Info [534802]
4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole Drug Info [534802]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [531079]
4-Benzyl-1-chroman-2-ylmethyl-piperidine Drug Info [527368]
4-Benzyl-1-chroman-3-ylmethyl-piperidine Drug Info [527368]
4-Benzyl-1-indan-2-ylmethyl-piperidine Drug Info [527368]
4-[3-(Methylsulfonyl)phenyl]-1-propylpiperidine Drug Info [530725]
7-(2-Amino-ethyl)-4-hydroxy-3H-benzothiazol-2-one Drug Info [533390]
7-(2-Dipropylamino-ethyl)-3H-benzothiazol-2-one Drug Info [533390]
A-690344 Drug Info [527867]
A-70108 Drug Info [530404]
A-706149 Drug Info [527843]
A-80426 Drug Info [527799]
Aniracetam Drug Info [551390]
ANOLOBINE Drug Info [528616]
ANONAINE Drug Info [528616]
Azaperone Drug Info [533796]
Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine Drug Info [525599]
Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine Drug Info [525599]
Bis-{[R-(-)-apomorphine-2-oxy]ethyl} ether Drug Info [529349]
BOLDINE Drug Info [525759]
BRL-25594 Drug Info [526544]
BRL-26175 Drug Info [533954]
CLEBOPRIDE Drug Info [526544]
D-189 Drug Info [529420]
D-190 Drug Info [529420]
D-192 Drug Info [529420]
D-193 Drug Info [529420]
D-203 Drug Info [529420]
D-210 Drug Info [529420]
D-218 Drug Info [529420]
D-219 Drug Info [529420]
D-220 Drug Info [529420]
D-237 Drug Info [529836]
D-264 Drug Info [530117]
D-315 Drug Info [531014]
D-366 Drug Info [530606]
EPIDEPRIDE Drug Info [533883]
Ethyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine Drug Info [533152]
ETICLOPRIDE Drug Info [530325]
Etoloxamine Drug Info [527160]
FLUANISONE Drug Info [533378]
FLUMEZAPINE Drug Info [533165]
FLUTROLINE Drug Info [533512]
GLAUCINE Drug Info [528616]
IBZM Drug Info [533883]
IODOPRIDE Drug Info [533883]
IODOSULPIRIDE Drug Info [533883]
ISOCLOZAPINE Drug Info [534532]
ISOLOXAPINE Drug Info [533577]
L-741626 Drug Info [551224]
MAZAPERTINE Drug Info [533800]
MCL-515 Drug Info [529850]
MCL-516 Drug Info [529850]
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide Drug Info [529734]
N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide Drug Info [529703]
N-Ethyl-2-methylnorapomorphine hydrochloride Drug Info [530150]
N-Ethyl-2-phenylnorapomorphine hydrochloride Drug Info [530150]
N-METHYLSPIPERONE Drug Info [527170]
N-Propyl-2-methylnorapomorphine hydrochloride Drug Info [530150]
N-Propyl-2-phenylnorapomorphine hydrochloride Drug Info [530150]
NOR-ROEFRACTINE Drug Info [534656]
OCTOCLOTHEPIN Drug Info [531171]
P2B-001 Drug Info [534641]
PD-128483 Drug Info [551251]
PD-135111 Drug Info [551251]
PD-135146 Drug Info [551251]
PD-135188 Drug Info [551251]
PD-135222 Drug Info [551251]
PD-135385 Drug Info [551251]
PD-135478 Drug Info [551251]
PD-135540 Drug Info [551251]
PD-137789 Drug Info [551251]
PD-137821 Drug Info [551251]
PD-168077 Drug Info [526495]
PD-172938 Drug Info [534794]
PD-172939 Drug Info [534794]
PG-01037 Drug Info [528974]
PGX-200097 Drug Info [531048]
Phenyltoloxamine Drug Info [527160]
Preclamol Drug Info [530318]
Propyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine Drug Info [533152]
PUKATEINE Drug Info [528616]
QUINPIROLE Drug Info [534764]
R-N-PROPYLNORAPOMORPHINE Drug Info [529289]
Ro-21-7767 Drug Info [533759]
Rolicyclidine Drug Info [551388]
ROXINDOLE Drug Info [527191]
SB-258719 Drug Info [526032]
SB-271046 Drug Info [529191]
SCH-24518 Drug Info [533416]
SK&F-89626 Drug Info [530341]
SKF-89124A Drug Info [533390]
SLV-314 Drug Info [527822]
SNAP-94847 Drug Info [528972]
SPIPERONE Drug Info [527368]
STEPHOLIDINE Drug Info [530374]
TIOSPIRONE Drug Info [534093]
UH-232 Drug Info [551330]
UH-301 Drug Info [534363]
WAY-208466 Drug Info [530209]
[2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine Drug Info [525599]
[R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether Drug Info [529349]
Antagonist (+)-S-14297 Drug Info [533585]
(S)-amisulpride Drug Info [536463]
1192U90 Drug Info [536463]
Acetophenazine Drug Info [535384], [537772]
Amisulpride Drug Info [535384], [536014], [536228]
Anti-D Drug Info [536737]
APD-403 Drug Info [543559]
Bevantolol Drug Info [536450], [536477]
BL-1020 Drug Info [536463]
Blonanserin Drug Info [536463]
Carphenazine Drug Info [535384], [537769]
Chlorpromazine Drug Info [537110], [537239], [538131]
Chlorprothixene Drug Info [536986]
CLR-151 Drug Info [543559]
D1 agonist D2 antagonist Drug Info [536463]
Dapiprazole Drug Info [535858]
Domperidone Drug Info [536906], [537754]
Flupenthixol Drug Info [535384], [537355]
Fluspirilene Drug Info [535367]
GMC-283 Drug Info [536463]
Haloperidol Drug Info [535384], [535507]
HMR-2934 Drug Info [536463]
Iloperidone Drug Info [530677], [536463]
Lamectacin Drug Info [536295], [536773]
Loxapine Drug Info [537966]
Metoclopramide Drug Info [536705], [537754]
ML321 Drug Info [525354]
nafadotride Drug Info [534073]
Nomifensine Drug Info [536298], [537851]
Org-23366 Drug Info [536463]
PD-157695 Drug Info [536463]
PD-158771 Drug Info [536463]
PD-172760 Drug Info [536463]
Perphenazine Drug Info [535922], [536570]
Phenoxybenzamine Drug Info [537093]
Phentolamine Drug Info [537387]
Pimozide Drug Info [535384], [536264]
Prochlorperazine Drug Info [536926], [537996]
Raclopride Drug Info [537994]
Remoxipride Drug Info [535384], [537966]
Risperidone Drug Info [536910], [537559]
RP5063 Drug Info [549962], [551645]
S-(-)-sulpiride Drug Info [535012], [535493], [537994]
Sertindole Drug Info [536632], [537440]
SLV-307 Drug Info [527204]
Sulpiride Drug Info [535012], [535493], [537994]
Thiethylperazine Drug Info [537675], [537780]
Thioridazine Drug Info [535616], [536045]
Thiothixene Drug Info [537727]
Tiapride Drug Info [535493]
Tolazoline Drug Info [536163]
Umespirone Drug Info [528329]
Zuclopenthixol Drug Info [534860], [535384]
[3H]N-methylspiperone Drug Info [525665]
[3H]nemonapride Drug Info [526842]
[3H]raclopride Drug Info [533499]
[3H]spiperone Drug Info [525818]
Agonist (-)-3PPP, Maryland Drug Info [536463]
(-)-N-porphynorapomorphine Drug Info [533725]
7-trans-OH-PIPAT Drug Info [533838]
AM-831 Drug Info [550322]
AMR-103 Drug Info [527798]
Aplindore fumarate Drug Info [536293], [536463]
Apomorphine Drug Info [529937]
Aripiprazole Drug Info [536421]
Bromocriptine Drug Info [537057], [537165], [537694]
Cabergoline Drug Info [536995], [537018]
Carmoxirole Drug Info [534755]
CQA 206-291 Drug Info [537689]
Dihydroergotamine Drug Info [536777]
Dihydroergotoxine Drug Info [534844]
Dopamine Drug Info [536358], [536407]
Entacapone+levodopa+carbidopa Drug Info [536121]
Ephedrine Drug Info [536322]
Ergonovine Drug Info [537710]
Fencamfamine Drug Info [537781]
Intranasal apomorphine Drug Info [534197]
JNJ-37822681 Drug Info [532392]
Lisuride Drug Info [536452], [536478], [537763]
LP-12 Drug Info [528956]
LP-211 Drug Info [529703]
LP-44 Drug Info [528956]
Lu-02-750 Drug Info [548986]
Mephentermine Drug Info [534972]
Mesoridazine Drug Info [536134]
Metaraminol Drug Info [538109]
Methamfetamine Drug Info [536103]
Methyldopa Drug Info [536417]
MLS1547 Drug Info [532749]
N-0923 Drug Info [536923]
Naphazoline Drug Info [534898]
Nemonapride Drug Info [536463]
NOLOMIROLE HYDROCHLORIDE Drug Info [526875], [551871]
Olanzapine Drug Info [535119]
Pardoprunox Drug Info [536580]
PD 128907 Drug Info [534074]
PF-03800130 Drug Info [543559]
Phenylephrine Drug Info [534861], [537397]
piribedil Drug Info [526443]
Quetiapine Drug Info [535384], [537077]
Quinagolide Drug Info [535476]
Rotigitine Drug Info [536285]
SAVOXEPIN MESYLATE Drug Info [533887], [551871]
Sumanirole Drug Info [536923]
Talipexole Drug Info [538017]
Uinagolide Drug Info [535476]
UNC0006 Drug Info [531673]
UNC9975 Drug Info [531673]
UNC9994 Drug Info [531673]
WS-50030 Drug Info [543559]
XP-21279 Drug Info [532587]
Y-20024 Drug Info [533174], [551871]
Ziprasidone Drug Info [536935]
Modulator Abaperidone Drug Info [553290]
ATI-9242 Drug Info [550651]
BAM-1110 Drug Info
Bifeprunox Drug Info
BIM23A760 Drug Info [528145]
BIMG80 Drug Info [534408]
Bis(olanzapine) pamoate monohydrate Drug Info [551871]
Cariprazine Drug Info [532651]
CGP-25454A Drug Info [533754]
CGS-15873A Drug Info [550026], [551871]
CLR-3001 Drug Info [549794]
CP-903397 Drug Info [548437]
Declopramide Drug Info [525463]
Denopamine Drug Info [536361]
Docarpamine Drug Info [536361]
Dopexamine Drug Info [536361]
DU-29894 Drug Info [533724]
E-2040 Drug Info [546599]
Etrabamine Drug Info [550139]
F-15063 Drug Info
FOSOPAMINE Drug Info [530448], [551871]
Ibopamine hci Drug Info [533417], [536361]
Levodopa Drug Info [540492]
Levomepromazine Drug Info [556264]
Lu-AE04621 Drug Info [549067]
Lurasidone hydrochloride Drug Info [530859], [531351]
LY-243062 Drug Info [545859]
Mazapertine succinate Drug Info
Naxagolide Drug Info [533809]
NGD-93-1 Drug Info [551646]
NNC-22-0031 Drug Info [534327]
Ocaperidone Drug Info [526792]
OPC-34712 Drug Info
Ordopidine Drug Info [532776]
Org-10490 Drug Info [556264]
PD-143188 Drug Info [534559]
Perazine Drug Info [527325], [551871]
Pergolide Drug Info [556264]
PF-217830 Drug Info
Piperacetazine Drug Info [556264]
PNU-96391A Drug Info [532971]
Pramipexole Drug Info [556264]
Pridopidine Drug Info [531022]
RBP-7000 Drug Info [532645]
Romergoline Drug Info [551899]
Ropinirole Drug Info [556264]
RWJ-25730 Drug Info
S-18327 Drug Info [525657]
S32504 Drug Info [526972]
Sarizotan Drug Info
SDZ-208911 Drug Info [528305], [551871]
SDZ-GLC-756 Drug Info [534322]
SDZ-MAR-327 Drug Info
SEL-73 Drug Info [543559]
Sibenadet Drug Info
SLV-310 Drug Info
SLV-313 Drug Info
SSR-181507 Drug Info
YKP-1358 Drug Info [528644]
Zicronapine Drug Info [549861]
Binder Droperidol Drug Info [535656]
Molindone Drug Info [536346], [538098]
SKL-10406 Drug Info [544111]
Y-931 Drug Info [536463]
ZD-3638 Drug Info [536463]
Stimulator Pseudoephedrine Drug Info [535332], [537761]
Modulator (allosteric modulator) SB269652 Drug Info [532915]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Rap1 signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson&#039
s disease
Cocaine addiction
Alcoholism
PANTHER Pathway Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway
Dopamine receptor mediated signaling pathway
Nicotine pharmacodynamics pathway
Reactome Dopamine receptors
G alpha (i) signalling events
WikiPathways Hypothetical Network for Drug Addiction
Monoamine GPCRs
GPCRs, Class A Rhodopsin-like
Genes and (Common) Pathways Underlying Drug Addiction
GPCR ligand binding
GPCR downstream signaling
Nicotine Activity on Dopaminergic Neurons
References
Ref 467478(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133).
Ref 467639(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 43).
Ref 467839(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46).
Ref 467939(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 47).
Ref 468021(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4792).
Ref 468029(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48).
Ref 468078(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 485).
Ref 468121(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 50).
Ref 468130(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 502).
Ref 468254(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 52).
Ref 468270(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5217).
Ref 521931ClinicalTrials.gov (NCT00408915) Continuous Application of Lisuride in Parkinson's Disease by Subcutaneous Infusion. U.S. National Institutes of Health.
Ref 522303ClinicalTrials.gov (NCT00665223) A Study of Treatment With ACR16 in Patients With Huntington's Disease. U.S. National Institutes of Health.
Ref 522393ClinicalTrials.gov (NCT00728195) An Efficacy and Safety Study of 3 Fixed Doses of JNJ-37822681 in Participants With Schizophrenia. U.S. National Institutes of Health.
Ref 523123ClinicalTrials.gov (NCT01171313) A Efficacy, Safety and Pharmacokinetic Study of XP21279 and Sinemet in Parkinson's Disease Subjects. U.S. National Institutes of Health.
Ref 523357ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health.
Ref 523551ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health.
Ref 523723ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health.
Ref 524298ClinicalTrials.gov (NCT01857232) Dose-finding Study of APD403 to Prevent Nausea and Vomiting After Chemotherapy. U.S. National Institutes of Health.
Ref 524487ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health.
Ref 524579ClinicalTrials.gov (NCT02020408) Monoamine Contributions to Neurocircuitry in Eating Disorders. U.S. National Institutes of Health.
Ref 524709ClinicalTrials.gov (NCT02109562) Randomized, Double-blind, Placebo Controlled, Multi-center and Tolerability of RBP-7000 in Schizophrenia Patients. U.S. National Institutes of Health.
Ref 524901ClinicalTrials.gov (NCT02231905) Safety, Tolerability and Efficacy of Switching From Talipexole to Pramipexole in Patients With Parkinson's Disease. U.S. National Institutes of Health.
Ref 525056ClinicalTrials.gov (NCT02339064) Infusion of Apomorphine: Long-term Safety Study. U.S. National Institutes of Health.
Ref 526084Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43.
Ref 526174Pharmacology of the atypical antipsychotic remoxipride, a dopamine D2 receptor antagonist. CNS Drug Rev. 2001 Fall;7(3):265-82.
Ref 526775Pharmacokinetics and first clinical experiences with an antihypertensive dopamine (DA2) agonist. Eur Heart J. 1992 Sep;13 Suppl D:121-8.
Ref 526776Pharmacologic properties of (-)-3PPP (preclamol) in man. J Neural Transm Gen Sect. 1992;88(3):165-75.
Ref 526792Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59.
Ref 526972S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20.
Ref 527086Intranasal apomorphine. Nastech Pharmaceutical. IDrugs. 2004 May;7(5):483-8.
Ref 528061Rotigotine: a novel dopamine agonist for the transdermal treatment of Parkinson's disease. Drugs Today (Barc). 2006 Jan;42(1):21-8.
Ref 528145BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7.
Ref 528387Sertindole: efficacy and safety in schizophrenia. Expert Opin Pharmacother. 2006 Sep;7(13):1825-34.
Ref 5292822007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9.
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 530859Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81.
Ref 531351Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
Ref 531697CQA 206-291: a novel dopamine agonist in the treatment of Parkinson's disease. Clin Neuropharmacol. 1990 Aug;13(4):303-11.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 532971The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9.
Ref 534084Roxindole: psychopharmacological profile of a dopamine D2 autoreceptor agonist. J Pharmacol Exp Ther. 1996 Jan;276(1):41-8.
Ref 5342521192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42.
Ref 534327NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78.
Ref 534644Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009.
Ref 534772Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7.
Ref 534844Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97.
Ref 535119Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61.
Ref 536103Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418.
Ref 536217Lisuride, a dopamine receptor agonist with 5-HT2B receptor antagonist properties: absence of cardiac valvulopathy adverse drug reaction reports supports the concept of a crucial role for 5-HT2B receptor agonism in cardiac valvular fibrosis. Clin Neuropharmacol. 2006 Mar-Apr;29(2):80-6.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536322The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 536526Emerging anxiolytics. Expert Opin Emerg Drugs. 2007 Nov;12(4):541-54.
Ref 536580Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2.
Ref 536661Anti-obesity drugs and neural circuits of feeding. Trends Pharmacol Sci. 2008 Apr;29(4):208-17. Epub 2008 Mar 18.
Ref 536732A systematic review of the efficacy of domperidone for the treatment of diabetic gastroparesis. Clin Gastroenterol Hepatol. 2008 Jul;6(7):726-33. Epub 2008 Jun 4.
Ref 536738Emerging drugs for acromegaly. Expert Opin Emerg Drugs. 2008 Jun;13(2):273-93.
Ref 536773How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30.
Ref 536814Behavioral responses of dopamine beta-hydroxylase knockout mice to modafinil suggest a dual noradrenergic-dopaminergic mechanism of action. Pharmacol Biochem Behav. 2008 Dec;91(2):217-22. Epub 2008 Jul 25.
Ref 536923Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
Ref 537476Persistence and compliance to antidepressant treatment in patients with depression: a chart review. BMC Psychiatry. 2009 Jun 16;9:38.
Ref 537532Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. Epub 2009 Apr 8.
Ref 537632Electrophysiological studies in the rat brain on the basis for aripiprazole augmentation of antidepressants in major depressive disorder. Psychopharmacology (Berl). 2009 Jul 30.
Ref 537885Migraine: a pharmacologic review with newer options and delivery modalities. Neurology. 1994 May;44(5 Suppl 3):S13-7.
Ref 538160FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040058.
Ref 538172FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040235.
Ref 538192FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040654.
Ref 538218FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070075.
Ref 538220FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070184.
Ref 538226FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070600.
Ref 538243FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 072123.
Ref 538291FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075153.
Ref 538339FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080439.
Ref 538343FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080722.
Ref 538368FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 088001.
Ref 538389FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006035.
Ref 538395FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006403.
Ref 538457FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012254.
Ref 538460FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012753.
Ref 538474FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016149.
Ref 538478FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016774.
Ref 538485FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017111.
Ref 538488FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017473.
Ref 538609(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 100).
Ref 538617(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101).
Ref 538723(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 121).
Ref 538934(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 148).
Ref 539311(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 207).
Ref 539323(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 209).
Ref 539343(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 212).
Ref 539539(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 241).
Ref 540260(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 33).
Ref 540346(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 34).
Ref 540438(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 35).
Ref 540492(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639).
Ref 540505(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 37).
Ref 540570(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3949).
Ref 540779(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 534).
Ref 540844(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5442).
Ref 540937(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 556).
Ref 541192(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 59).
Ref 542148(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7140).
Ref 542182(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7172).
Ref 542242(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7227).
Ref 542244(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7229).
Ref 542299(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7279).
Ref 542306(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7286).
Ref 542315(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295).
Ref 542328(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7306).
Ref 542333(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7310).
Ref 542486(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461).
Ref 542559(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7559).
Ref 542649(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670).
Ref 542650(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671).
Ref 542651(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672).
Ref 543051(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 83).
Ref 543173(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 85).
Ref 543216(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 86).
Ref 543255(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87).
Ref 543290(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 90).
Ref 543312(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 94).
Ref 543313(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 940).
Ref 543322(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953).
Ref 543327(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 96).
Ref 543328(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 960).
Ref 543330(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 963).
Ref 543331(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 965).
Ref 543333(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 968).
Ref 543343(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 98).
Ref 543347(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 983).
Ref 544058Optimizing levodopa therapy for Parkinson's disease with levodopa/carbidopa/entacapone: implications from a clinical and patient perspective. Neuropsychiatr Dis Treat. 2008 February; 4(1): 39-47.
Ref 544679Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562)
Ref 544699Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000647)
Ref 544712Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698)
Ref 544868Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001374)
Ref 544873Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001388)
Ref 544883Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001412)
Ref 544888Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422)
Ref 544892Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430)
Ref 545125Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002218)
Ref 545255Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002585)
Ref 545272Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002657)
Ref 545274Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662)
Ref 545340Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002902)
Ref 545464Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364)
Ref 545467Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003368)
Ref 545667Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004095)
Ref 545858Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079)
Ref 545888Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232)
Ref 546028Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005971)
Ref 546043Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006017)
Ref 546146Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596)
Ref 546239Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007055)
Ref 546521Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736)
Ref 546598Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126)
Ref 546690Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009651)
Ref 547082Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012906)
Ref 547323Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015146)
Ref 547459Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551)
Ref 548315Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024498)
Ref 548392Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025217)
Ref 548436Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558)
Ref 548438Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025560)
Ref 548466Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025731)
Ref 548528Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348)
Ref 548733Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028165)
Ref 548985Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195)
Ref 549066Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909)
Ref 549113Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032468)
Ref 549136Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727)
Ref 549998Methamphetamine Addiction and Abuse - Perphenazine.
Ref 550679Drug information of Zuclopenthixol, 2008. eduDrugs.
Ref 550709Drug information of Fencamfamine, 2008. eduDrugs.
Ref 550728Drug information of Fluspirilene, 2008. eduDrugs.
Ref 550749Drug information of Carphenazine, 2008. eduDrugs.
Ref 551583Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology &#38 Therapeutics. 02/1999; 65(2).
Ref 551630ORG 10490: A new antipsychotic drug with 5-HT2 and DA antagonistic properties. ScienceDirect, Volume 6, Issue 2, January 1992, Pages 111.
Ref 551815Small Molecule Therapeutics for Schizophrenia, Sylvain Celanire. Page(30).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525354Discovery, optimization, and characterization of a novel series of dopamine D2 versus D3 receptor selective antagonists. Probe Reports from the NIH Molecular Libraries Program [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2010-.
Ref 525463Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88.
Ref 525599Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template.
Ref 525629Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands.
Ref 525657S18327 (1-[2-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)piperid-1-yl]ethyl]3-phenyl imidazolin-2-one), a novel, potential antipsychotic displaying marked antagonist properties at alpha(1)- and alpha(2)-adrenergic receptors: I. Receptorial, neurochemical, and electrophysiological profile. J Pharmacol Exp Ther. 2000 Jan;292(1):38-53.
Ref 525665Nonconserved residues in the second transmembrane-spanning domain of the D(4) dopamine receptor are molecular determinants of D(4)-selective pharmacology. Mol Pharmacol. 2000 Jan;57(1):144-52.
Ref 525701J Med Chem. 2000 Feb 24;43(4):756-62.Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonists recognizing preferentially the D(3) subtype.
Ref 525759J Nat Prod. 2000 Apr;63(4):480-4.Halogenated boldine derivatives with enhanced monoamine receptor selectivity.
Ref 525818Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59.
Ref 526032J Med Chem. 2001 Apr 26;44(9):1337-40.Atropisomeric derivatives of 2',6'-disubstituted (R)-11-phenylaporphine: selective serotonin 5-HT(7) receptor antagonists.
Ref 526443Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804.
Ref 526495J Med Chem. 2003 Jan 2;46(1):161-8.New N-n-propyl-substituted 3-aryl- and 3-cyclohexylpiperidines as partial agonists at the D4 dopamine receptor.
Ref 526544J Med Chem. 2003 Feb 27;46(5):702-15.Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotonin 5-HT3 and dopamine D2 receptor antagonistic activity.
Ref 526792Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59.
Ref 526822J Med Chem. 1992 Oct 30;35(22):3984-90.6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists.
Ref 526842Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41.
Ref 526875Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5.
Ref 526972S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20.
Ref 527160J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity.
Ref 527170J Med Chem. 1992 Feb 7;35(3):423-30.Effect of N-alkylation on the affinities of analogues of spiperone for dopamine D2 and serotonin 5-HT2 receptors.
Ref 527191J Med Chem. 2004 Sep 9;47(19):4677-83.Indolebutylamines as selective 5-HT(1A) agonists.
Ref 527204Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9.
Ref 527325Synthesis and in vitro binding of N-phenyl piperazine analogs as potential dopamine D3 receptor ligands. Bioorg Med Chem. 2005 Jan 3;13(1):77-87.
Ref 527368J Med Chem. 2005 Jan 13;48(1):266-73.Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands.
Ref 527798ACP-103, a 5-HT2A/2C inverse agonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Psychopharmacology (Berl). 2005 Dec;183(2):144-53. Epub 2005 Nov 9.
Ref 527799J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm.
Ref 527822J Med Chem. 2005 Nov 3;48(22):6855-69.Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential antipsychotics combining potent dopamine D2 receptor antagonism with potent serotonin reuptake inhibition.
Ref 527843Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. Epub 2005 Nov 2.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.geneste@abbott.com.
Ref 527867Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. Epub 2005 Nov 11.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives.
Ref 528099Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype.
Ref 528145BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7.
Ref 528305Effects of the partial dopamine receptor agonists SDZ 208-911, SDZ 208-912 and terguride on central monoamine receptors. A behavioral, biochemical and electrophysiological study. Naunyn SchmiedebergsArch Pharmacol. 1991 Sep;344(3):263-74.
Ref 528329The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96.
Ref 528493J Med Chem. 2006 Nov 2;49(22):6607-13.Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition.
Ref 528616J Med Chem. 2007 Jan 25;50(2):171-81.Advances in development of dopaminergic aporphinoids.
Ref 528644Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8.
Ref 528876Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. Epub 2007 May 23.R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands.
Ref 528904Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand.
Ref 528956Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. Epub 2007 Jul 25.
Ref 528972J Med Chem. 2007 Aug 9;50(16):3883-90.Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key fragments of HTS hits.
Ref 528974J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents.
Ref 529191Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists.
Ref 529289J Med Chem. 2008 Feb 28;51(4):983-7. Epub 2008 Feb 6.Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selectivity.
Ref 529328Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. Epub 2008 Feb 5.Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines.
Ref 529349Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. Epub 2008 Feb 15.Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines.
Ref 529371J Med Chem. 1991 Oct;34(10):2946-53.Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands.
Ref 529420J Med Chem. 2008 May 22;51(10):3005-19. Epub 2008 Apr 12.Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly potent and selective agonists for dopamine D3 receptor with potent in vivo activity.
Ref 529703J Med Chem. 2008 Sep 25;51(18):5813-22.Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor activity. Part III.
Ref 529734J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies.
Ref 529836J Med Chem. 2008 Dec 25;51(24):7806-19.Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding characterization at D2/D3 receptors and elucidation of a pharmacophore model.
Ref 529850Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. Epub 2008 Nov 13.Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines.
Ref 529937Dopamine D(2/3) receptor occupancy of apomorphine in the nonhuman primate brain--a comparative PET study with [11C]raclopride and [11C]MNPA. Synapse. 2009 May;63(5):378-89.
Ref 530114J Med Chem. 2009 Jun 11;52(11):3548-62.Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships.
Ref 530117Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. Epub 2009 Apr 19.Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol: effect on affinity and selectivity for dopamine D3 receptor.
Ref 530150Bioorg Med Chem. 2009 Jul 1;17(13):4756-62. Epub 2009 May 3.N-Substituted-2-alkyl- and 2-arylnorapomorphines: novel, highly active D2 agonists.
Ref 530209Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. Epub 2009 May 29.Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists.
Ref 530310J Med Chem. 1990 Jan;33(1):311-7.4-(1,2,5,6-Tetrahydro-1-alkyl-3-pyridinyl)-2-thiazolamines: a novel class of compounds with central dopamine agonist properties.
Ref 530318J Med Chem. 1990 Mar;33(3):1015-22.Pre- and postsynaptic dopaminergic activities of indolizidine and quinolizidine derivatives of 3-(3-hydroxyphenyl)-N-(n-propyl)piperidine (3-PPP). Further developments of a dopamine receptor model.
Ref 530325J Med Chem. 1990 Apr;33(4):1155-63.Potential antipsychotic agents 5. Synthesis and antidopaminergic properties of substituted 5,6-dimethoxysalicylamides and related compounds.
Ref 530341J Med Chem. 1990 Jun;33(6):1756-64.trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist.
Ref 530342J Med Chem. 1990 Jun;33(6):1800-5.Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues.
Ref 530374Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?.
Ref 530404J Med Chem. 1990 Nov;33(11):2948-50.(1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist.
Ref 530448Development of dopaminergic drugs for the chronic treatment of congestive heart failure. J Auton Pharmacol. 1990;10 Suppl 1:s85-93.
Ref 530558Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine.
Ref 530606J Med Chem. 2010 Feb 11;53(3):1023-37.Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a D3 receptor preferring agonist: potent in vivo activity in Parkinson's disease animal models.
Ref 530677Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
Ref 530725J Med Chem. 2010 Mar 25;53(6):2510-20.Synthesis and evaluation of a set of 4-phenylpiperidines and 4-phenylpiperazines as D2 receptor ligands and the discovery of the dopaminergic stabilizer 4-[3-(methylsulfonyl)phenyl]-1-propylpiperidine (huntexil, pridopidine, ACR16).
Ref 530859Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81.
Ref 530927J Med Chem. 2010 Jun 24;53(12):4803-7.Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors.
Ref 531014Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. Epub 2010 Jun 12.Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol.
Ref 531022Efficacy and safety of the dopaminergic stabilizer Pridopidine (ACR16) in patients with Huntington's disease. Clin Neuropharmacol. 2010 Sep-Oct;33(5):260-4.
Ref 531048Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23.
Ref 531079J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
Ref 531171J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for |A(1)-adrenoceptors.
Ref 531351Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
Ref 531673Discovery of beta-arrestin-biased dopamine D2 ligands for probing signal transduction pathways essential for antipsychotic efficacy. Proc Natl Acad Sci U S A. 2011 Nov 8;108(45):18488-93.
Ref 532392Population pharmacokinetics of JNJ-37822681, a selective fast-dissociating dopamine D??receptor antagonist, in healthy subjects and subjects with schizophrenia and dose selection based on simulated D??receptor occupancy. Clin Pharmacokinet. 2013 Nov;52(11):1005-15.
Ref 532587Double-blind study of the actively transported levodopa prodrug XP21279 in Parkinson's disease. Mov Disord. 2014 Jan;29(1):75-82.
Ref 532645Population pharmacokinetics and prediction of dopamine D2 receptor occupancy after multiple doses of RBP-7000, a new sustained-release formulation of risperidone, in schizophrenia patients on stable oral risperidone treatment. Clin Pharmacokinet. 2014 Jun;53(6):533-43.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 532749Discovery and characterization of a G protein-biased agonist that inhibits beta-arrestin recruitment to the D2 dopamine receptor. Mol Pharmacol. 2014 Jul;86(1):96-105.
Ref 532776The dopaminergic stabilizers pridopidine and ordopidine enhance cortico-striatal Arc gene expression. J Neural Transm. 2014 Nov;121(11):1337-47.
Ref 532915A new mechanism of allostery in a G protein-coupled receptor dimer. Nat Chem Biol. 2014 Sep;10(9):745-52.
Ref 532971The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9.
Ref 533152J Med Chem. 1989 Oct;32(10):2388-96.Substituted 5-amino-4,5,6,7-tetrahydroindazoles as partial ergoline structures with dopaminergic activity.
Ref 533165J Med Chem. 1989 Dec;32(12):2573-82.Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics.
Ref 533174Neuroleptic properties of Y-20024, a new benzofurancarboxamide derivative. Nihon Yakurigaku Zasshi. 1989 Nov;94(5):269-80.
Ref 533378J Med Chem. 1987 Nov;30(11):2099-104.2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1.
Ref 533390J Med Chem. 1987 Jul;30(7):1166-76.Synthesis and evaluation of non-catechol D-1 and D-2 dopamine receptor agonists: benzimidazol-2-one, benzoxazol-2-one, and the highly potent benzothiazol-2-one 7-ethylamines.
Ref 533416J Med Chem. 1988 Oct;31(10):1941-6.Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands.
Ref 533417Ibopamine. A preliminary review of its pharmacodynamic and pharmacokinetic properties and therapeutic efficacy. Drugs. 1988 Jul;36(1):11-31.
Ref 533499Specific in vitro and in vivo binding of 3H-raclopride. A potent substituted benzamide drug with high affinity for dopamine D-2 receptors in the rat brain. Biochem Pharmacol. 1985 Jul 1;34(13):2251-9.
Ref 533512J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines.
Ref 533570J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain.
Ref 533577J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain.
Ref 533578J Med Chem. 1981 Sep;24(9):1107-10.Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists.
Ref 533585Functional correlates of dopamine D3 receptor activation in the rat in vivo and their modulation by the selective antagonist, (+)-S 14297: 1. Activation of postsynaptic D3 receptors mediates hypothermia, whereas blockade of D2 receptors elicits prolactin secretion and catalepsy. J Pharmacol Exp Ther. 1995 Nov;275(2):885-98.
Ref 533724A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14.
Ref 533725A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32.
Ref 533754CGP 25454A, a novel and selective presynaptic dopamine autoreceptor antagonist. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):230-8.
Ref 533759J Med Chem. 1995 Jan 20;38(2):318-27.Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine receptor ligands.
Ref 533796J Med Chem. 1993 Nov 26;36(24):3929-36.Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors.
Ref 533800J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects.
Ref 533809Comparison between the pharmacology of dopamine receptors mediating the inhibition of cell firing in rat brain slices through the substantia nigra pars compacta and ventral tegmental area. Br J Pharmacol. 1994 Jul;112(3):873-80.
Ref 533838Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50.
Ref 533883J Med Chem. 1993 Jan 22;36(2):221-8.Fluorinated and iodinated dopamine agents: D2 imaging agents for PET and SPECT.
Ref 533887Savoxepine: striatal dopamine-D2 receptor occupancy in human volunteers measured using positron emission tomography (PET). Eur J Clin Pharmacol. 1993;44(2):135-40.
Ref 533938J Med Chem. 1993 Oct 15;36(21):3188-96.Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists.
Ref 533954J Med Chem. 1993 Nov 12;36(23):3707-20.18F-labeled benzamides for studying the dopamine D2 receptor with positron emission tomography.
Ref 534073Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46.
Ref 534074Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66.
Ref 534093J Med Chem. 1996 Jan 5;39(1):143-8.3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents.
Ref 534131J Med Chem. 1996 May 10;39(10):1941-2.3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4 receptor.
Ref 534197Dopamine agonists used in the treatment of Parkinson's disease and their selectivity for the D1, D2, and D3 dopamine receptors in human striatum. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1147-54.
Ref 534244J Med Chem. 1996 Oct 11;39(21):4285-98.3-amino-3,4-dihydro-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 2. Synthesis and quantitative structure-activity relationship studies of spiro[pyrrolidine- and piperidine-2,3'(2'H)-benzopyrans].
Ref 534322SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30.
Ref 534327NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78.
Ref 534363J Med Chem. 1997 Apr 11;40(8):1252-7.N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor.
Ref 534408BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90.
Ref 534532J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic.
Ref 534559Anxiolytic effects of dopamine receptor ligands: I. Involvement of dopamine autoreceptors. Life Sci. 1998;62(7):649-63.
Ref 534641Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51.
Ref 534656J Nat Prod. 1998 Jun 26;61(6):709-12.Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine.
Ref 534755Neurohumoral response to carmoxirole, a selective dopamine (D2) receptor agonist, in patients with chronic moderate heart failure. Cardiovasc Drugs Ther. 1998 Sep;12(4):387-94.
Ref 534764J Med Chem. 1998 Dec 3;41(25):4933-8.N-n-Propyl-substituted 3-(dimethylphenyl)piperidines display novel discriminative properties between dopamine receptor subtypes: synthesis and receptor binding studies.
Ref 534794Bioorg Med Chem Lett. 1998 Jun 16;8(12):1499-502.Isoindolinone enantiomers having affinity for the dopamine D4 receptor.
Ref 534802Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template.
Ref 534844Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97.
Ref 534860An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5.
Ref 534861Intracellular Ca2+ and adrenergic responsiveness of cardiac myocytes in streptozotocin-induced diabetes. Clin Exp Pharmacol Physiol. 1999 Apr;26(4):347-53.
Ref 534898Decongestants in treatment of nasal obstruction. Otolaryngol Pol. 1999;53(3):347-52.
Ref 534972Present state of alpha- and beta-adrenergic drugs I. The adrenergic receptor. Am Heart J. 1976 Nov;92(5):661-4.
Ref 535012D(2) dopamine receptors enable delta(9)-tetrahydrocannabinol induced memory impairment and reduction of hippocampal extracellular acetylcholine concentration. Br J Pharmacol. 2000 Jul;130(6):1201-10.
Ref 535119Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61.
Ref 535332Cetirizine/pseudoephedrine. Drugs. 2001;61(15):2231-40; discussion 2241-2.
Ref 535367Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41.
Ref 535384Atypical antipsychotics: mechanism of action. Can J Psychiatry. 2002 Feb;47(1):27-38.
Ref 535476Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8.
Ref 535493The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914.
Ref 535507Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85.
Ref 535616Models of drug treatment in the attention deficit disorder with hyperactivity. Rev Neurol. 2002 Feb;34 Suppl 1:S98-S106.
Ref 535656Alpha-adrenergic blockade: a possible mechanism of tocolytic action of certain benzodiazepines in a postpartum rat model in vivo. Life Sci. 2003 Jan 24;72(10):1093-102.
Ref 535858Effect of ibopamine on aqueous humor production in normotensive humans. Invest Ophthalmol Vis Sci. 2003 Nov;44(11):4853-8.
Ref 535922A cross-validation study on the relationship between central D2 receptor occupancy and serum perphenazine concentration. Psychopharmacology (Berl). 2004 Sep;175(2):148-53. Epub 2004 Mar 6.
Ref 536014Amisulpride: a review of its use in the management of schizophrenia. CNS Drugs. 2004;18(13):933-56.
Ref 536045Antipsychotics lack alpha 1A/B adrenoceptor subtype selectivity in the rat. Eur Neuropsychopharmacol. 2005 Mar;15(2):231-4.
Ref 536103Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418.
Ref 536121Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52.
Ref 536134Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as a D2/D3 partial agonist. J Pharmacol Exp Ther. 2005Dec;315(3):1278-87. Epub 2005 Aug 31.
Ref 536163Comparative effects of tolazoline and nitroprusside on human isolated radial artery. Ann Thorac Surg. 2006 Jan;81(1):125-31.
Ref 536228Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409.
Ref 536264The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536293Aplindore (DAB-452), a high affinity selective dopamine D2 receptor partial agonist. Eur J Pharmacol. 2006 Dec 15;552(1-3):36-45. Epub 2006 Sep 14.
Ref 536295Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34.
Ref 536298Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9.
Ref 536322The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7.
Ref 536346Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083.
Ref 536358The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536407Polymorphisms in dopamine receptor DRD1 and DRD2 genes and psychopathological and extrapyramidal symptoms in patients on long-term antipsychotic treatment. Am J Med Genet B Neuropsychiatr Genet. 2007Sep 5;144B(6):809-15.
Ref 536417Centrally acting antihypertensive agents: an update. J Clin Hypertens (Greenwich). 2007 May;9(5):399-405.
Ref 536421Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5.
Ref 536450Different changes of plasma membrane beta-adrenoceptors in rat heart after chronic administration of propranolol, atenolol and bevantolol. Life Sci. 2007 Jul 12;81(5):399-404. Epub 2007 Jun 16.
Ref 536452Medical management of levodopa-associated motor complications in patients with Parkinson's disease. CNS Drugs. 2007;21(8):677-92.
Ref 536463The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31.
Ref 536477Determination of bevantolol in human plasma by high performance liquid chromatography using solid phase extraction technique. Arch Pharm Res. 2007 Jul;30(7):890-7.
Ref 536478Fibrotic heart-valve reactions to dopamine-agonist treatment in Parkinson's disease. Lancet Neurol. 2007 Sep;6(9):826-9.
Ref 536570CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93.
Ref 536580Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2.
Ref 536632Dopamine D2(High) receptors moderately elevated by sertindole. Synapse. 2008 May;62(5):389-93.
Ref 536705Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6. Epub 2008 Apr 6.
Ref 536737Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
Ref 536773How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30.
Ref 536777Current and prospective pharmacological targets in relation to antimigraine action. Naunyn Schmiedebergs Arch Pharmacol. 2008 Oct;378(4):371-94. Epub 2008 Jul 15.
Ref 536906Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31. Epub 2005 Jul 22.
Ref 536910Upcoming agents for the treatment of schizophrenia: mechanism of action, efficacy and tolerability. Drugs. 2008;68(16):2269-92.
Ref 536923Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
Ref 536926In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102. Epub 2008 Oct 15.
Ref 536935Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). JClin Psychopharmacol. 2008 Dec;28(6):608-17.
Ref 536986Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42. Epub 2008 Sep 7.
Ref 536995Protection against paraquat and A53T alpha-synuclein toxicity by cabergoline is partially mediated by dopamine receptors. J Neurol Sci. 2009 Mar 15;278(1-2):44-53. Epub 2008 Dec 21.
Ref 537018Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7.
Ref 537057Striatal dopamine predicts outcome-specific reversal learning and its sensitivity to dopaminergic drug administration. J Neurosci. 2009 Feb 4;29(5):1538-43.
Ref 537077Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40. Epub 2009 Feb 13.
Ref 537093Catecholamine-secreting neuroblastoma in a 4-month-old infant: perioperative management. J Clin Anesth. 2009 Feb;21(1):54-6.
Ref 537110Basolateral amygdala D1- and D2-dopaminergic system promotes the formation of long-term potentiation in the dentate gyrus of anesthetized rats. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Apr 30;33(3):552-6. Epub 2009 Feb 23.
Ref 537165Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44. Epub 2009 Mar 20.
Ref 537239Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral amygdala-dentate gyrus pathway of anesthetized rats. Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3. Epub 2009 Jan 22.
Ref 537355A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606.
Ref 537387Nesfatin-1 exerts cardiovascular actions in brain: possible interaction with the central melanocortin system. Am J Physiol Regul Integr Comp Physiol. 2009 Aug;297(2):R330-6. Epub 2009 May 27.
Ref 537397MMP-2 Induced Vein Relaxation via Inhibition of [Ca(2+)](e)-Dependent Mechanisms of Venous Smooth Muscle Contraction. Role of RGD Peptides. J Surg Res. 2008 Oct 24.
Ref 537440Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with risperidone and exploration of mechanisms involved. Psychopharmacology (Berl). 2009 Jun 9.
Ref 537559Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8.
Ref 537675Torecan-induced neuroleptic malignant syndrome. Harefuah. 1990 May 15;118(10):576-8.
Ref 537689The antiparkinsonian activity of CQA 206-291, a new D2 dopamine receptor agonist. Clin Neuropharmacol. 1989 Feb;12(1):55-9.
Ref 537694The behavioral toxicity of bromocriptine in patients with psychiatric illness. J Clin Psychopharmacol. 1989 Dec;9(6):417-22.
Ref 537710Agonist profile of ergometrine (ergonovine) on a population of postsynaptic alpha-adrenoceptors. J Pharm Pharmacol. 1988 Feb;40(2):137-9.
Ref 537727Dopaminergic stimulation of cAMP accumulation in cultured rat mesangial cells. Am J Physiol. 1987 Aug;253(2 Pt 2):H358-64.
Ref 537754The significance of disordered gastric emptying. Z Gastroenterol. 1986 Sep;24 Suppl 2:45-54.
Ref 537761Drugs for cough and cold symptoms in hypertensive patients. Am Fam Physician. 1985 Mar;31(3):183-7.
Ref 537763Tolerance to some behavioural effects of lisuride, a dopamine receptor agonist, and reverse tolerance to others, after repeated administration. Neuropharmacology. 1985 Mar;24(3):199-206.
Ref 537769Comparison of dosage ranges of carphenazine and trifluoperazine in elderly chronic schizophrenics. Dis Nerv Syst. 1968 Oct;29(10):695-7.
Ref 537772Specific therapeutic actions of acetophenazine, perphenazine, and benzquinamide in newly admitted schizophrenic patients. Clin Pharmacol Ther. 1967 Mar-Apr;8(2):249-55.
Ref 537780Antiemetic specificity of dopamine antagonists. Psychopharmacology (Berl). 1982;78(3):210-3.
Ref 537781Dopamine uptake inhibiting versus dopamine releasing properties of fencamfamine: an in vitro study. Biochem Pharmacol. 1983 Aug 1;32(15):2329-31.
Ref 537851Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9.
Ref 537966Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45.
Ref 537994The effects of antipsychotic drugs on Fos protein expression in the prefrontal cortex: cellular localization and pharmacological characterization. Neuroscience. 1996 Jan;70(2):377-89.
Ref 537996Tardive dyskinesia as a result of long-term prochlorperazine use. South Med J. 1996 Oct;89(10):989-91.
Ref 538017Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82.
Ref 538098Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry. 1998 Mar;3(2):123-34.
Ref 538109Alpha1-adrenoceptor stimulation enhances experimental gastric carcinogenesis induced by N-methyl-N'-nitro-N-nitrosoguanidine in Wistar rats. Int J Cancer. 1998 Jul 29;77(3):467-9.
Ref 538131Behavioral and neurochemical methods in research on new psychotropics. Ann Pharm Fr. 1998;56(2):54-9.
Ref 540492(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639).
Ref 543559(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 215).
Ref 544111Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793.
Ref 545859Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079)
Ref 546599Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126)
Ref 548437Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558)
Ref 548986Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195)
Ref 549067Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909)
Ref 549794Clinical pipeline report, company report or official report of Clera Inc.
Ref 549861Clinical pipeline report, company report or official report of Lundbeck.
Ref 549962Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271
Ref 550026Biochemical and pharmacological characterization of the putative dopamine autoreceptor agonist benzopyranopyridine, CGS 15873A. Article first published online: 5 OCT 2004.
Ref 550139WO patent application no. 2009,0568,11, Medicaments.
Ref 550322Clinical pipeline report, company report or official report of Avarx.
Ref 550651Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12.
Ref 551224Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. doi: 10.1016/j.bmc.2010.05.052. Epub 2010 May 24.
Ref 551251Synthesis and pharmacological evaluation of the enantiomers of the dopamine autoreceptor agonist PD 135385, Bioorg. Med. Chem. Lett. 3(4):639-644 (1993).
Ref 551330(Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997).
Ref 551334Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
Ref 551342D4 dopamine receptor-selective compounds from the Chinese plant Phoebe chekiangensis, Bioorg. Med. Chem. Lett. 7(9):1207-1212 (1997).
Ref 551356Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6.
Ref 551388Leung K: 4-Acetoxy-7-chloro-3-(3-(-4-[11C]methoxybenzyl)phenyl)-2(1H)-quinolone.
Ref 551390Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43.
Ref 551645EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22.
Ref 551646Dopamine D4 receptors in human postmortem brain tissue of normal and schizophrenic subjects. An [3]NGD-94-1 study. Schizophrenia Research Volume 29, Issues 1-2, January 1998, Pages 93.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551899CA patent application no. 648479, Implants for the treatment of dopamine associated states.
Ref 5532907-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.