Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64977
|
||||
| Former ID |
TTDI02245
|
||||
| Target Name |
mRNA of Insulin-like growth factor 1 receptor
|
||||
| Gene Name |
IGF1R
|
||||
| Synonyms |
CD221 (mRNA); IGF1R (mRNA); IGFI receptor (mRNA); Insulinlike growth factor 1 receptor (mRNA); Insulinlike growth factor 1 receptor beta chain (mRNA); Insulinlike growth factor I receptor (mRNA); IGF1R
|
||||
| Target Type |
Research
|
||||
| Disease | Psoriatic disorder [ICD9: 696; ICD10: L40] | ||||
| Function |
When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
|
||||
| BioChemical Class |
Target of antisense drug
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| FoxO signaling pathway | |||||
| Oocyte meiosis | |||||
| Endocytosis | |||||
| PI3K-Akt signaling pathway | |||||
| AMPK signaling pathway | |||||
| Focal adhesion | |||||
| Adherens junction | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Long-term depression | |||||
| Ovarian steroidogenesis | |||||
| Progesterone-mediated oocyte maturation | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Proteoglycans in cancer | |||||
| Glioma | |||||
| Prostate cancer | |||||
| Melanoma | |||||
| PANTHER Pathway | Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade | ||||
| Insulin/IGF pathway-protein kinase B signaling cascade | |||||
| Pathway Interaction Database | Plasma membrane estrogen receptor signaling | ||||
| SHP2 signaling | |||||
| IGF1 pathway | |||||
| Posttranslational regulation of adherens junction stability and dissassembly | |||||
| Integrins in angiogenesis | |||||
| Stabilization and expansion of the E-cadherin adherens junction | |||||
| Reactome | IRS-related events triggered by IGF1R | ||||
| SHC-related events triggered by IGF1R | |||||
| WikiPathways | Senescence and Autophagy in Cancer | ||||
| Insulin Signaling | |||||
| Endochondral Ossification | |||||
| Focal Adhesion | |||||
| Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
| Apoptosis | |||||
| Signaling Pathways in Glioblastoma | |||||
| TSH signaling pathway | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| References | |||||
| Ref 528173 | Diarylureas are small-molecule inhibitors of insulin-like growth factor I receptor signaling and breast cancer cell growth. Mol Cancer Ther. 2006 Apr;5(4):1079-86. | ||||
| Ref 529864 | Optimization of a series of 4,6-bis-anilino-1H-pyrrolo[2,3-d]pyrimidine inhibitors of IGF-1R: elimination of an acid-mediated decomposition pathway. Bioorg Med Chem Lett. 2009 Jan 15;19(2):373-7. | ||||
| Ref 531679 | Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol. 2011 Oct 30;29(11):1046-51. | ||||
| Ref 534345 | Specific inhibition of insulin-like growth factor-1 and insulin receptor tyrosine kinase activity and biological function by tyrphostins. Endocrinology. 1997 Apr;138(4):1427-33. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.