Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T53585
|
||||
| Former ID |
TTDS00195
|
||||
| Target Name |
3-hydroxy-3-methylglutaryl-coenzyme A reductase
|
||||
| Gene Name |
HMGCR
|
||||
| Synonyms |
HMG coA reductase; HMG-CoA reductase; HMGCR
|
||||
| Target Type |
Successful
|
||||
| Disease | Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | ||||
| Arteriosclerosis [ICD9: 440; ICD10: I70] | |||||
| Cardiovascular disease; Hyperlipidemia; Dyslipidemia [ICD10: I00-I99, E78] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Chemotherapy or radiotherapy-induced mucositis [ICD9: 338, 528.0,780; ICD10: K12.3, R52, G89] | |||||
| Dyslipidaemias [ICD9: 272; ICD10: E78] | |||||
| Elevated CRP [ICD10: E78.0] | |||||
| HBV infection [ICD9: 070.2-070.3; ICD10: B16, B18.0, B18.1] | |||||
| Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
| Hypercholesterolemia [ICD10: E78] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Myocardial infarction; Cerebrovascular ischaemia [ICD9: 410, 434.91; ICD10: I21, I22, I61-I63] | |||||
| Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
|
||||
| BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
| Target Validation |
T53585
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.1.1.34
|
||||
| Sequence |
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Atorvastatin | Drug Info | Approved | Cardiovascular disease; Hyperlipidemia; Dyslipidemia | [551871] |
| Cerivastatin | Drug Info | Approved | Hyperlipidaemia | [539962], [545021] | |
| Crestor/TriLipix | Drug Info | Approved | Dyslipidaemias | [551871] | |
| Fluvastatin | Drug Info | Approved | Hypercholesterolemia | [537114], [539963] | |
| Lovastatin | Drug Info | Approved | Hypercholesterolemia | [537114], [539783] | |
| PITAVASTATIN CALCIUM | Drug Info | Approved | Dyslipidaemias | [545795], [551871] | |
| Pravastatin | Drug Info | Approved | Hypercholesterolemia | [536361], [539964] | |
| Pravigard | Drug Info | Approved | Myocardial infarction; Cerebrovascular ischaemia | [536186] | |
| Rosuvastatin | Drug Info | Approved | Hypercholesterolemia | [536372], [539965] | |
| Simvastatin | Drug Info | Approved | Hypercholesterolemia | [537114], [539966] | |
| Simvistatin | Drug Info | Approved | Hyperlipidaemia | [536186] | |
| TOCOTRIENOL | Drug Info | Approved | Hyperlipidaemia | [532347] | |
| NK-104 | Drug Info | Phase 4 | Discovery agent | [523598] | |
| Premarin/Pravachol | Drug Info | Phase 3 | Hyperlipidaemia | [535747] | |
| Rosuvastatin | Drug Info | Phase 3 | Elevated CRP | [536372], [539965] | |
| CRILVASTATIN | Drug Info | Phase 2 | Hyperlipidaemia | [545138] | |
| XZK-monascus | Drug Info | Phase 2 | Hyperlipidaemia | [549393] | |
| Statins | Drug Info | Phase 1/2 | Multiple myeloma | [537114] | |
| NCX-6560 | Drug Info | Phase 1 | Cardiovascular disorder | [535747] | |
| Simvistatin | Drug Info | Phase 1 | HBV infection | [536186] | |
| HMG-CoA reductase inhibitor | Drug Info | Preclinical | Chemotherapy or radiotherapy-induced mucositis | [536838] | |
| Dalvastatin | Drug Info | Discontinued in Phase 3 | Hyperlipidaemia | [545019] | |
| MK-0524B | Drug Info | Discontinued in Phase 3 | Atherosclerosis | [548247] | |
| Bervastatin | Drug Info | Discontinued in Phase 2 | Thrombosis | [545145] | |
| BMY-21950 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [539994], [545157] | |
| GLENVASTATIN | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [544823] | |
| RBx10558 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [548403] | |
| PF-3052334 | Drug Info | Discontinued in Phase 1 | Atherosclerosis | [548433] | |
| BMY-22089 | Drug Info | Terminated | Hyperlipidaemia | [539985], [545692] | |
| CP-83101 | Drug Info | Terminated | Arteriosclerosis | [544592] | |
| GT-16-239 | Drug Info | Terminated | Arteriosclerosis | [546960] | |
| Mevastatin | Drug Info | Terminated | Discovery agent | [540037], [545220] | |
| SQ-33600 | Drug Info | Terminated | Hyperlipidaemia | [545154] | |
| SR12813 | Drug Info | Terminated | Arteriosclerosis | [539809], [545153] | |
| Inhibitor | (E)-5-octadecen-7,9-diynoic acid | Drug Info | [551349] | ||
| (E)-octadecan-9-ynoic acid | Drug Info | [551349] | |||
| (R)-Mevalonate | Drug Info | [551393] | |||
| (Z)-5-octadecen-7,9-diynoic acid | Drug Info | [551349] | |||
| (Z)-7-octedecan-9-ynoic acid | Drug Info | [551349] | |||
| 1,4-Dithiothreitol | Drug Info | [551393] | |||
| 2'-Monophosphoadenosine 5'-Diphosphoribose | Drug Info | [551393] | |||
| 3-(1,3 dodecadiynyl)-6-oxiranebutanoic acid | Drug Info | [551349] | |||
| 3-Hydroxy-3-Methyl-Glutaric Acid | Drug Info | [551393] | |||
| 5-ketodihydromevinolin | Drug Info | [533473] | |||
| 6-hydroxy-7,9-octadecadiynoic acid | Drug Info | [551349] | |||
| 7,9-octadecadiynoic acid | Drug Info | [551349] | |||
| 7,9-tetradecadiynoic acid | Drug Info | [551349] | |||
| 9-octadecynoic acid | Drug Info | [551349] | |||
| Adenosine-5'-Diphosphate | Drug Info | [551391] | |||
| Atorvastatin | Drug Info | [535246] | |||
| Bervastatin | Drug Info | [526518] | |||
| BMY-21950 | Drug Info | [532472], [551871] | |||
| BMY-22089 | Drug Info | [532472], [551871] | |||
| BPL-001 | Drug Info | [543905] | |||
| Brutieridin | Drug Info | [543905] | |||
| Cerivastatin | Drug Info | [535663] | |||
| Coenzyme A | Drug Info | [551393] | |||
| compound 1 | Drug Info | [529773] | |||
| compound 1 (Patel et al., 1991) | Drug Info | [543905] | |||
| compound 11dd | Drug Info | [528092] | |||
| compound 11ff | Drug Info | [528092] | |||
| compound 11jj | Drug Info | [528092] | |||
| compound 11nn | Drug Info | [528092] | |||
| compound 13 | Drug Info | [530524] | |||
| compound 13b | Drug Info | [529423] | |||
| compound 13b | Drug Info | [531456] | |||
| compound 13g | Drug Info | [531456] | |||
| compound 16f | Drug Info | [529232] | |||
| compound 17 | Drug Info | [527410] | |||
| compound 17 | Drug Info | [533477] | |||
| compound 18 | Drug Info | [529660] | |||
| compound 18 | Drug Info | [534034] | |||
| compound 18t | Drug Info | [533953] | |||
| compound 1a | Drug Info | [531456] | |||
| compound 1e | Drug Info | [531456] | |||
| compound 1f | Drug Info | [531456] | |||
| compound 2 (Dreyer et al., 1991) | Drug Info | [543905] | |||
| compound 25 | Drug Info | [532035] | |||
| compound 25d | Drug Info | [530191] | |||
| compound 28 | Drug Info | [533951] | |||
| compound 29 | Drug Info | [527151] | |||
| compound 29 | Drug Info | [527410] | |||
| compound 29 | Drug Info | [532035] | |||
| compound 29f | Drug Info | [528887] | |||
| compound 2c | Drug Info | [531456] | |||
| compound 2d | Drug Info | [531456] | |||
| compound 2f | Drug Info | [531456] | |||
| compound 2g | Drug Info | [532037] | |||
| compound 2t | Drug Info | [532037] | |||
| compound 33 | Drug Info | [528899] | |||
| compound 35 | Drug Info | [533951] | |||
| compound 3h | Drug Info | [533952] | |||
| compound 3j | Drug Info | [531791] | |||
| compound 3k | Drug Info | [531791] | |||
| compound 3q | Drug Info | [531791] | |||
| compound 3u | Drug Info | [531791] | |||
| compound 4 (Balasubramanian et al., 1992) | Drug Info | [543905] | |||
| compound 41 | Drug Info | [528898] | |||
| compound 42 | Drug Info | [528898] | |||
| compound 4d | Drug Info | [532037] | |||
| compound 4ff | Drug Info | [528092] | |||
| compound 4i | Drug Info | [532037] | |||
| compound 4p | Drug Info | [529773] | |||
| compound 4rr | Drug Info | [528092] | |||
| compound 50 | Drug Info | [529210] | |||
| compound 5ab | Drug Info | [533951] | |||
| compound 6a (Patil et al., 1989) | Drug Info | [543905] | |||
| compound 6v | Drug Info | [529773] | |||
| compound 7 | Drug Info | [533384] | |||
| compound 74 | Drug Info | [528092] | |||
| compound 8b | Drug Info | [530523] | |||
| compound 9 | Drug Info | [527607] | |||
| compound 9 | Drug Info | [533814] | |||
| compound 9a (Patil et al., 1989) | Drug Info | [543905] | |||
| CP-83101 | Drug Info | [532476] | |||
| Crestor/TriLipix | Drug Info | [550288] | |||
| CRILVASTATIN | Drug Info | [534229], [551871] | |||
| Dalvastatin | Drug Info | [534036] | |||
| DFGYVAE | Drug Info | [530939] | |||
| F(4-Fluoro)VAE | Drug Info | [529130] | |||
| Fluvastatin | Drug Info | [535246] | |||
| FPYVAE peptide | Drug Info | [530939] | |||
| GFPDGG | Drug Info | [529130] | |||
| GFPEGG | Drug Info | [529130] | |||
| GFPTGG | Drug Info | [529130] | |||
| GLENVASTATIN | Drug Info | [533833], [551871] | |||
| GLPDGG peptide | Drug Info | [530939] | |||
| GLPTGG | Drug Info | [529130] | |||
| HMG-CoA reductase inhibitor | Drug Info | [536838] | |||
| Lovastatin | Drug Info | [535491] | |||
| Meglutol | Drug Info | [527409] | |||
| MK-0524B | Drug Info | [549718], [550977] | |||
| NCX-6560 | Drug Info | [535747] | |||
| Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
| NK-104 | Drug Info | [535153] | |||
| o-hydroxyatorvastatin | Drug Info | [529527] | |||
| PF-3052334 | Drug Info | [529210] | |||
| PITAVASTATIN CALCIUM | Drug Info | [529042] | |||
| Pravastatin | Drug Info | [535442] | |||
| Pravigard | Drug Info | [536186] | |||
| RBx10558 | Drug Info | [544419] | |||
| Rosuvastatin | Drug Info | [535680] | |||
| Simvastatin | Drug Info | [535246] | |||
| Simvistatin | Drug Info | [536186] | |||
| SQ-33600 | Drug Info | [527403] | |||
| Statins | Drug Info | [536740], [537114] | |||
| TOCOTRIENOL | Drug Info | [526580], [551871] | |||
| Modulator | GT-16-239 | Drug Info | [534777] | ||
| MT-001 | Drug Info | [543905] | |||
| NCX-1067 | Drug Info | [543905] | |||
| Premarin/Pravachol | Drug Info | [535747] | |||
| rawsonol | Drug Info | ||||
| SR12813 | Drug Info | ||||
| Statin | Drug Info | [543905] | |||
| XZK-monascus | Drug Info | [531854] | |||
| Antagonist | Mevastatin | Drug Info | [551386] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) | ||||
| Superpathway of cholesterol biosynthesis | |||||
| Mevalonate pathway | |||||
| KEGG Pathway | Terpenoid backbone biosynthesis | ||||
| Metabolic pathways | |||||
| Biosynthesis of antibiotics | |||||
| AMPK signaling pathway | |||||
| Bile secretion | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| TSH Signaling Pathway | |||||
| PANTHER Pathway | Cholesterol biosynthesis | ||||
| PathWhiz Pathway | Steroid Biosynthesis | ||||
| WikiPathways | Statin Pathway | ||||
| Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
| Activation of Gene Expression by SREBP (SREBF) | |||||
| SREBF and miR33 in cholesterol and lipid homeostasis | |||||
| Integrated Breast Cancer Pathway | |||||
| SREBP signalling | |||||
| Cholesterol Biosynthesis | |||||
| References | |||||
| Ref 523598 | ClinicalTrials.gov (NCT01422382) Drug-Drug Interaction of Cardizem LA (Diltiazem Hydrochloride) on Pitavastatin. U.S. National Institutes of Health. | ||||
| Ref 532347 | Vitamin E: tocopherols and tocotrienols as potential radiation countermeasures. J Radiat Res. 2013 Nov 1;54(6):973-88. | ||||
| Ref 535747 | Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26. | ||||
| Ref 536186 | Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536372 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 539783 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2739). | ||||
| Ref 539809 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2763). | ||||
| Ref 539962 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2950). | ||||
| Ref 539963 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2951). | ||||
| Ref 539964 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2953). | ||||
| Ref 539965 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2954). | ||||
| Ref 539966 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2955). | ||||
| Ref 539985 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2973). | ||||
| Ref 539994 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2981). | ||||
| Ref 540037 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3031). | ||||
| Ref 544592 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000245) | ||||
| Ref 544823 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001230) | ||||
| Ref 545019 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001903) | ||||
| Ref 545021 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001906) | ||||
| Ref 545138 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002276) | ||||
| Ref 545145 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002290) | ||||
| Ref 545153 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002306) | ||||
| Ref 545154 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002307) | ||||
| Ref 545157 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002314) | ||||
| Ref 545220 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002490) | ||||
| Ref 545692 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004222) | ||||
| Ref 545795 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004764) | ||||
| Ref 546960 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011586) | ||||
| Ref 548247 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023729) | ||||
| Ref 548403 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025331) | ||||
| Ref 548433 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025539) | ||||
| Ref 526518 | Effects of simvastatin, an HMG-CoA reductase inhibitor, in patients with hypertriglyceridemia. Clin Cardiol. 2003 Jan;26(1):18-24. | ||||
| Ref 526580 | Inhibitory effect of delta-tocotrienol, a HMG CoA reductase inhibitor, on monocyte-endothelial cell adhesion. J Nutr Sci Vitaminol (Tokyo). 2002 Oct;48(5):332-7. | ||||
| Ref 527151 | Synthesis and biological evaluation of dihydroeptastatin, a novel inhibitor of 3-hydroxy-3-methylglutaryl coenzyme A reductase. J Med Chem. 1992 Sep 4;35(18):3388-93. | ||||
| Ref 527403 | Determination of SQ 33,600, a phosphinic acid containing HMG CoA reductase inhibitor, in human serum by high-performance liquid chromatography combined with ionspray mass spectrometry. Biol Mass Spectrom. 1992 Apr;21(4):189-94. | ||||
| Ref 527409 | Bioorg Med Chem Lett. 2005 Feb 15;15(4):989-94.Molecular docking of the highly hypolipidemic agent alpha-asarone with the catalytic portion of HMG-CoA reductase. | ||||
| Ref 527410 | Three-dimensional quantitative structure (3-D QSAR) activity relationship studies on imidazolyl and N-pyrrolyl heptenoates as 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) inhibitors by comparativemolecular similarity indices analysis (CoMSIA). Bioorg Med Chem Lett. 2005 Feb 15;15(4):1027-32. | ||||
| Ref 527607 | Inhibitors of cholesterol biosynthesis. 6. trans-6-[2-(2-N-heteroaryl-3,5-disubstituted- pyrazol-4-yl)ethyl/ethenyl]tetrahydro-4-hydroxy-2H-pyran-2-ones. J Med Chem. 1992 May 29;35(11):2095-103. | ||||
| Ref 528092 | Synthesis and biological activity of new HMG-CoA reductase inhibitors. 3. Lactones of 6-phenoxy-3,5-dihydroxyhexanoic acids. J Med Chem. 1991 Oct;34(10):2962-83. | ||||
| Ref 528887 | Discovery of pyrrole-based hepatoselective ligands as potent inhibitors of HMG-CoA reductase. Bioorg Med Chem. 2007 Aug 15;15(16):5576-89. Epub 2007 May 17. | ||||
| Ref 528898 | Design and synthesis of novel, conformationally restricted HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4531-7. Epub 2007 Jun 6. | ||||
| Ref 528899 | Design and synthesis of hepatoselective, pyrrole-based HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4538-44. Epub 2007 Jun 6. | ||||
| Ref 529042 | Bioorg Med Chem. 2007 Dec 15;15(24):7809-29. Epub 2007 Aug 28.Synthesis and HMG CoA reductase inhibition of 4-thiophenyl quinolines as potential hypocholesterolemic agents. | ||||
| Ref 529130 | Bioorg Med Chem. 2008 Feb 1;16(3):1309-18. Epub 2007 Oct 23.Binding effect and design of a competitive inhibitory peptide for HMG-CoA reductase through modeling of an active peptide backbone. | ||||
| Ref 529210 | J Med Chem. 2008 Jan 10;51(1):31-45. Epub 2007 Dec 12.Substituted pyrazoles as hepatoselective HMG-CoA reductase inhibitors: discovery of (3R,5R)-7-[2-(4-fluoro-phenyl)-4-isopropyl-5-(4-methyl-benzylcarbamoyl)-2H-pyrazol-3-yl]-3,5-dihydroxyheptanoic acid (PF-3052334) as a candidate for the treatment of hypercholesterolemia. | ||||
| Ref 529232 | Hepatoselectivity of statins: design and synthesis of 4-sulfamoyl pyrroles as HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2008 Feb 1;18(3):1151-6. Epub 2007 Dec 5. | ||||
| Ref 529423 | (3R,5S,E)-7-(4-(4-fluorophenyl)-6-isopropyl-2-(methyl(1-methyl-1h-1,2,4-triazol-5-yl)amino)pyrimidin-5-yl)-3,5-dihydroxyhept-6-enoic acid (BMS-644950): a rationally designed orally efficacious 3-hydroxy-3-methylglutaryl coenzyme-a reductase inhibitor with reduced myotoxicity potential. J Med Chem. 2008 May 8;51(9):2722-33. | ||||
| Ref 529527 | Thermodynamic and structure guided design of statin based inhibitors of 3-hydroxy-3-methylglutaryl coenzyme A reductase. J Med Chem. 2008 Jul 10;51(13):3804-13. | ||||
| Ref 529660 | 3-Hydroxy-3-methylglutaryl-coenzyme a reductase inhibitors. 7. Modification of the hexahydronaphthalene moiety of simvastatin: 5-oxygenated and 5-oxa derivatives. J Med Chem. 1991 Aug;34(8):2489-95. | ||||
| Ref 529773 | Phosphorus-containing inhibitors of HMG-CoA reductase. 2. Synthesis and biological activities of a series of substituted pyridines containing a hydroxyphosphinyl moiety. J Med Chem. 1991 Sep;34(9):2804-15. | ||||
| Ref 530191 | Application of a 3,3-diphenylpentane skeleton as a multi-template for creation of HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4228-31. | ||||
| Ref 530523 | Inhibitors of cholesterol biosynthesis. 4. trans-6-[2-(substituted-quinolinyl)ethenyl/ethyl]tetrahydro-4-hydroxy-2 H-pyran-2-ones, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1991 Jan;34(1):367-73. | ||||
| Ref 530524 | Relationship between tissue selectivity and lipophilicity for inhibitors of HMG-CoA reductase. J Med Chem. 1991 Jan;34(1):463-6. | ||||
| Ref 530939 | Peptide fragmentation as an approach in modeling of an active peptide and designing a competitive inhibitory peptide for HMG-CoA reductase. Bioorg Med Chem. 2010 Jun 15;18(12):4300-9. | ||||
| Ref 531456 | Synthesis and biological activity of new HMG-CoA reductase inhibitors. 2. Derivatives of 7-(1H-pyrrol-3-yl)-substituted-3,5-dihydroxyhept-6(E)-enoic (-heptanoic) acids. J Med Chem. 1990 Jan;33(1):61-70. | ||||
| Ref 531791 | Phosphorus-containing inhibitors of HMG-CoA reductase. 1. 4-[(2-arylethyl)hydroxyphosphinyl]-3-hydroxy-butanoic acids: a new class of cell-selective inhibitors of cholesterol biosynthesis. J Med Chem. 1990 Nov;33(11):2952-6. | ||||
| Ref 531854 | NMR evaluation of total statin content and HMG-CoA reductase inhibition in red yeast rice (Monascus spp.) food supplements. Chin Med. 2012 Mar 22;7:8. | ||||
| Ref 532035 | Inhibitors of cholesterol biosynthesis. 2. 1,3,5-trisubstituted [2-(tetrahydro-4-hydroxy-2-oxopyran-6-yl)ethyl]pyrazoles. J Med Chem. 1990 Jan;33(1):31-8. | ||||
| Ref 532037 | Synthesis and biological activity of new HMG-CoA reductase inhibitors. 1. Lactones of pyridine- and pyrimidine-substituted 3,5-dihydroxy-6-heptenoic (-heptanoic) acids. J Med Chem. 1990 Jan;33(1):52-60. | ||||
| Ref 532472 | Selective inhibition of cholesterol synthesis in liver versus extrahepatic tissues by HMG-CoA reductase inhibitors. J Lipid Res. 1990 Jul;31(7):1271-82. | ||||
| Ref 532476 | Efficacy, tissue distribution and biliary excretion of methyl (3R*,5S*)-(E)-3,5-dihydroxy-9,9-diphenyl-6,8-nonadienoate (CP-83101), a hepatoselective inhibitor of HMG-CoA reductase activity in the rat. Biochem Pharmacol. 1990 Sep 15;40(6):1281-93. | ||||
| Ref 533384 | Synthesis and biological evaluation of a monocyclic, fully functional analogue of compactin. J Med Chem. 1989 Jan;32(1):197-202. | ||||
| Ref 533473 | Total synthesis and biological evaluation of structural analogues of compactin and dihydromevinolin. J Med Chem. 1987 Oct;30(10):1858-73. | ||||
| Ref 533477 | 3-Hydroxy-3-methylglutaryl-coenzyme A reductase inhibitors. 5. 6-(Fluoren-9-yl)- and 6-(fluoren-9-ylidenyl)-3,5-dihydroxyhexanoic acids and their lactone derivatives. J Med Chem. 1986 May;29(5):852-5. | ||||
| Ref 533814 | Synthesis and biological activity of bile acid-derived HMG-CoA reductase inhibitors. The role of 21-methyl in recognition of HMG-CoA reductase and the ileal bile acid transport system. J Med Chem. 1994 Sep 30;37(20):3240-6. | ||||
| Ref 533833 | Bile acid derived HMG-CoA reductase inhibitors. Biochim Biophys Acta. 1994 Nov 29;1227(3):137-54. | ||||
| Ref 533951 | Inhibitors of cholesterol biosynthesis. 1. 3,5-Dihydroxy-7-(N-imidazolyl)-6-heptenoates and -heptanoates, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1993 Nov 12;36(23):3646-57. | ||||
| Ref 533952 | Inhibitors of cholesterol biosynthesis. 2. 3,5-Dihydroxy-7-(N-pyrrolyl)-6-heptenoates, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1993 Nov 12;36(23):3658-62. | ||||
| Ref 533953 | HMG-CoA reductase inhibitors: design, synthesis, and biological activity of tetrahydroindazole-substituted 3,5-dihydroxy-6-heptenoic acid sodium salts. J Med Chem. 1993 Nov 12;36(23):3674-85. | ||||
| Ref 534034 | 32-Methyl-32-oxylanosterols: dual-action inhibitors of cholesterol biosynthesis. J Med Chem. 1993 Feb 5;36(3):410-6. | ||||
| Ref 534036 | RG 12561 (dalvastatin): a novel synthetic inhibitor of HMG-CoA reductase and cholesterol-lowering agent. Pharmacology. 1993;46(1):13-22. | ||||
| Ref 534229 | Differences in hypolipidaemic effects of two statins on Hep G2 cells or human hepatocytes in primary culture. Br J Pharmacol. 1996 Aug;118(7):1862-8. | ||||
| Ref 534777 | Studies of cholesterol and bile acid metabolism, and early atherogenesis in hamsters fed GT16-239, a novel bile acid sequestrant (BAS). Atherosclerosis. 1998 Oct;140(2):315-24. | ||||
| Ref 535153 | Cholesterol-lowering effect of NK-104, a 3-hydroxy-3-methylglutaryl-coenzyme A reductase inhibitor, in guinea pig model of hyperlipidemia. Arzneimittelforschung. 2001;51(3):197-203. | ||||
| Ref 535246 | Equally potent inhibitors of cholesterol synthesis in human hepatocytes have distinguishable effects on different cytochrome P450 enzymes. Biopharm Drug Dispos. 2000 Dec;21(9):353-64. | ||||
| Ref 535442 | A randomized, double-blind trial comparing the efficacy and safety of pitavastatin versus pravastatin in patients with primary hypercholesterolemia. Atherosclerosis. 2002 Jun;162(2):373-9. | ||||
| Ref 535491 | Microarray and biochemical analysis of lovastatin-induced apoptosis of squamous cell carcinomas. Neoplasia. 2002 Jul-Aug;4(4):337-46. | ||||
| Ref 535663 | HMG-CoA reductase inhibitor has protective effects against stroke events in stroke-prone spontaneously hypertensive rats. Stroke. 2003 Jan;34(1):157-63. | ||||
| Ref 535680 | New dimension of statin action on ApoB atherogenicity. Clin Cardiol. 2003 Jan;26(1 Suppl 1):I7-10. | ||||
| Ref 535747 | Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26. | ||||
| Ref 536186 | Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90. | ||||
| Ref 536838 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
| Ref 543905 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 639). | ||||
| Ref 544419 | New Frontiers in the Treatment of Diabetic Dyslipidemia. Rev Diabet Stud. 2013 Summer-Fall; 10(2-3): 204-212. | ||||
| Ref 549718 | A novel c-Met inhibitor, MK8033, synergizes with carboplatin plus paclitaxel to inhibit ovarian cancer cell growth. Oncol Rep. 2013 May;29(5):2011-8. | ||||
| Ref 550977 | Selective Targeting of CTNBB1-, KRAS- or MYC-Driven Cell Growth by Combinations of Existing Drugs. PLoS One. 2015 May 27;10(5):e0125021. doi: 10.1371/journal.pone.0125021. eCollection 2015. | ||||
| Ref 551349 | Novel Acetylenic Acids from the Root Bark of Paramacrolobium caeruleum: Inhibitors of 3-Hydroxy-3-methyl-glutaryl Coenzyme A Reductase J. Nat. Prod. 52(1):153-161 (1989). | ||||
| Ref 551386 | Regulation of CYP2B6 and CYP3A expression by hydroxymethylglutaryl coenzyme A inhibitors in primary cultured human hepatocytes. Drug Metab Dispos. 2002 Dec;30(12):1400-5. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.