Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T34563
|
||||
| Former ID |
TTDR00089
|
||||
| Target Name |
D-amino acid aminotransferase
|
||||
| Gene Name |
dat
|
||||
| Synonyms |
D-alanine aminotransferase; D-amino acid transaminase; D-aspartate aminotransferase; DAAT; dat
|
||||
| Target Type |
Research
|
||||
| Function |
Acts on the D-isomers of alanine, leucine, aspartate, glutamate, aminobutyrate, norvaline and asparagine. The enzyme transfers an amino group from a substrate D-amino acid to the pyridoxal phosphate cofactor to form pyridoxamine andan alpha- keto acid in the first half-reaction. The second half-reaction is the reverse of the first, transferring the amino group from the pyridoxamine to a second alpha-keto acid to form the product D- amino acid via a ping-pong mechanism. This is an important process in the formation of D-alanine and D-glutamate, which are essential bacterial cell wall components (By similarity).
|
||||
| BioChemical Class |
Transferases of nitrogenous groups
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.6.1.21
|
||||
| Sequence |
MTKVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQ
LDLGYTVEELIDVVRELLKVNNIQNGGIYIQATRGVAPRNHSFPTPEVKPVIMAFAKSYD RPYDDLENGINAATVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAGEAIQHRGETVTEGA SSNVYAIKDGAIYTHPVNNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVS STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIESRSS |
||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.