Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T24334
|
||||
| Former ID |
TTDR00596
|
||||
| Target Name |
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
|
||||
| Gene Name |
dut
|
||||
| Synonyms |
DUTP pyrophosphatase; DUTPase; Deoxyuridine 5'-triphosphate nucleotidohydrolase; Deoxyuridine triphosphate nucleotidohydrolase; dut
|
||||
| Target Type |
Research
|
||||
| Function |
This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.
|
||||
| BioChemical Class |
Acid anhydrides hydrolase
|
||||
| Target Validation |
T24334
|
||||
| UniProt ID | |||||
| EC Number |
EC3.6.1.23
|
||||
| Sequence |
MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIAD
PSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMI FVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ |
||||
| Inhibitor | 1-(3-tritylaminopropyl)uracil | Drug Info | [528293] | ||
| 1-[(Z)-4-trityloxy-2-butenyl]uracil | Drug Info | [528293] | |||
| 1-[2-(trityloxy)ethoxymethyl]uracil | Drug Info | [528293] | |||
| 1-[4-hydroxy-3-(tritylaminomethyl)butyl]uracil | Drug Info | [528293] | |||
| 2'-deoxyuridine 5'-alpha,beta-imido-diphosphate | Drug Info | [551391] | |||
| 2'-Deoxyuridine 5'-Alpha,Beta-Imido-Triphosphate | Drug Info | [551393] | |||
| 2'-deoxyuridylic acid | Drug Info | [551393] | |||
| Acetate Ion | Drug Info | [551393] | |||
| Deoxyuridine-5'-Diphosphate | Drug Info | [551391] | |||
| Deoxyuridine-5'-Triphosphate | Drug Info | [551393] | |||
| Pathways | |||||
| PANTHER Pathway | De novo pyrimidine deoxyribonucleotide biosynthesis | ||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.