Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T10052
|
||||
Former ID |
TTDR00786
|
||||
Target Name |
G1/S-specific cyclin E1
|
||||
Gene Name |
CCNE1
|
||||
Synonyms |
Cyclin E; G1/S-specific cyclin E; CCNE1
|
||||
Target Type |
Discontinued
|
||||
Disease | Retinoblastoma [ICD10: C69.2] | ||||
Function |
Essential for the control of the cell cycle at the G1/S (start) transition.
|
||||
Target Validation |
T10052
|
||||
UniProt ID | |||||
Sequence |
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA |
||||
Drugs and Mode of Action | |||||
Inhibitor | (2'Z,3'E)-5-Chloro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | ||
(2'Z,3'E)-5-Chloro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Chloro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Chloro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Fluoro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Fluoro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Fluoro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Fluoro-5'-methoxy-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Fluoro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Nitro-5'-chloro-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Nitro-5'-fluoro-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Nitro-5'-hydroxy-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Nitro-5'-methoxy-indirubin-3'-oxime | Drug Info | [530823] | |||
(2'Z,3'E)-5-Nitro-5'-methyl-indirubin-3'-oxime | Drug Info | [530823] | |||
2-((3,5-diamino-1H-pyrazol-4-yl)diazenyl)phenol | Drug Info | [528490] | |||
3,4-di-(4-methoxyphenyl)-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3,4-diphenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3-((3,5-diamino-1H-pyrazol-4-yl)diazenyl)phenol | Drug Info | [528490] | |||
3-(4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3-(indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
4-(7-Butyl-5H-pyrrolo[2,3-b]pyrazin-6-yl)-phenol | Drug Info | [526504] | |||
4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | |||
5-nitroindirubin-3'-oxime | Drug Info | [530823] | |||
BMS-536924 | Drug Info | [527711] | |||
PD-0183812 | Drug Info | [525924] | |||
Pathways | |||||
KEGG Pathway | Cell cycle | ||||
Oocyte meiosis | |||||
p53 signaling pathway | |||||
PI3K-Akt signaling pathway | |||||
Hepatitis B | |||||
Measles | |||||
Pathways in cancer | |||||
Viral carcinogenesis | |||||
MicroRNAs in cancer | |||||
Prostate cancer | |||||
Small cell lung cancer | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
TCR Signaling Pathway | |||||
PANTHER Pathway | Cell cycle | ||||
Parkinson disease | |||||
p53 pathway | |||||
p53 pathway feedback loops 2 | |||||
Pathway Interaction Database | Signaling events mediated by PRL | ||||
E2F transcription factor network | |||||
mTOR signaling pathway | |||||
FOXM1 transcription factor network | |||||
BARD1 signaling events | |||||
PLK3 signaling events | |||||
Regulation of retinoblastoma protein | |||||
Reactome | E2F mediated regulation of DNA replication | ||||
G0 and Early G1 | |||||
SCF(Skp2)-mediated degradation of p27/p21 | |||||
DNA Damage/Telomere Stress Induced Senescence | |||||
Cyclin E associated events during G1/S transition | |||||
G1/S-Specific Transcription | |||||
p53-Dependent G1 DNA Damage Response | |||||
WikiPathways | DNA Damage Response | ||||
ID signaling pathway | |||||
G1 to S cell cycle control | |||||
Retinoblastoma (RB) in Cancer | |||||
Integrated Pancreatic Cancer Pathway | |||||
Parkinsons Disease Pathway | |||||
Parkin-Ubiquitin Proteasomal System pathway | |||||
Signaling Pathways in Glioblastoma | |||||
TSH signaling pathway | |||||
Mitotic G1-G1/S phases | |||||
Cell Cycle | |||||
miRNAs involved in DNA damage response | |||||
miRNA Regulation of DNA Damage Response | |||||
Androgen receptor signaling pathway | |||||
References | |||||
Ref 525924 | J Med Chem. 2000 Nov 30;43(24):4606-16.Pyrido[2,3-d]pyrimidin-7-one inhibitors of cyclin-dependent kinases. | ||||
Ref 526504 | J Med Chem. 2003 Jan 16;46(2):222-36.Aloisines, a new family of CDK/GSK-3 inhibitors. SAR study, crystal structure in complex with CDK2, enzyme selectivity, and cellular effects. | ||||
Ref 527711 | J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity. | ||||
Ref 528032 | J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. | ||||
Ref 528490 | J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.