Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T50970
|
||||
| Former ID |
TTDR00135
|
||||
| Target Name |
Endothelin-converting enzyme 1
|
||||
| Gene Name |
ECE1
|
||||
| Synonyms |
ECE-1; ECE1
|
||||
| Target Type |
Discontinued
|
||||
| Function |
Converts big endothelin-1 to endothelin-1.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T50970
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.24.71
|
||||
| Sequence |
MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWA
ARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVD PCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQV YYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVY VSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAI RPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVE INESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLS TLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNF SWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGG IGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSNYSVNGEPVN GRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTP ESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 5-(2-hydroxyethyl)nonane-1,9-diol | Drug Info | [551374] | ||
| CGS 35066 | Drug Info | [535609] | |||
| compound 22 | Drug Info | [530505] | |||
| LY-292223 | Drug Info | [527383] | |||
| PD159790 | Drug Info | [543449] | |||
| PO3 2-Ile-Trp-O-3K | Drug Info | [551263] | |||
| PO3 2-Leu-Nal-O-3K | Drug Info | [551263] | |||
| PO3 2-Leu-Trp-O-3K | Drug Info | [551263] | |||
| PO3 2-Nle-Trp-O-3K | Drug Info | [551263] | |||
| SCH-54470 | Drug Info | [530505] | |||
| Pathways | |||||
| PANTHER Pathway | Endothelin signaling pathway | ||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Corticotropin-releasing hormone | |||||
| Endothelin Pathways | |||||
| References | |||||
| Ref 527383 | J Med Chem. 2005 Jan 27;48(2):483-98.Endothelin-converting enzyme-1 inhibition and growth of human glioblastoma cells. | ||||
| Ref 530505 | J Med Chem. 2010 Jan 14;53(1):208-20.Phosphinic tripeptides as dual angiotensin-converting enzyme C-domain and endothelin-converting enzyme-1 inhibitors. | ||||
| Ref 535609 | The therapeutic potential of endothelin-1 receptor antagonists and endothelin-converting enzyme inhibitors on the cardiovascular system. Expert Opin Investig Drugs. 2002 Nov;11(11):1537-52. | ||||
| Ref 543449 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1615). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.